DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ehbp1 and CG13366

DIOPT Version :9

Sequence 1:NP_995865.2 Gene:Ehbp1 / 36912 FlyBaseID:FBgn0034180 Length:1141 Species:Drosophila melanogaster
Sequence 2:NP_001036254.1 Gene:CG13366 / 31004 FlyBaseID:FBgn0025633 Length:1094 Species:Drosophila melanogaster


Alignment Length:379 Identity:94/379 - (24%)
Similarity:152/379 - (40%) Gaps:92/379 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QQLEHMTTSLNGCIDVATPQSVPSLSEDPTPLAESFNPLHFE-----------LDADGKREAANK 263
            ||||.:|.  .......|||||.|..:....:|...:.|.|.           :::....:|..|
  Fly   780 QQLEKLTK--QQMQQSETPQSVLSTVQREMEMATRRSKLSFSRQDSRLSVKTLIESIENNKAQGK 842

  Fly   264 LDLPTAASGGSSGAEESLKTPNGLQHVVDQTPIKSPDEVKQPKQTPVESLRSKTNEDFDKMVTST 328
            .|  .:.|..||.:..:..||:     :..|||..|     |.....||:|.       .::.||
  Fly   843 AD--ESESHYSSTSSLNSGTPD-----LGTTPIIFP-----PSSDWHESIRL-------PVLQST 888

  Fly   329 PLEPNVNKD---------------DVKPKKKRALFFTEKEDEQDLRVESVKEDTTKTIGDNSTTK 378
            .|..||..:               |:....|..|   ...|:|.|.:.|              |:
  Fly   889 NLHVNVGNEVGAGQGTNTSSGSGGDLASTTKATL---PLRDQQQLAITS--------------TQ 936

  Fly   379 EKPKEESQSSKDASSVVVPSAKRPELQPLNLKKSYEPSQTPESAPVPASVINESIGSCFSTSGSL 443
            .:.:..||.|..|:.....|:....|...|:.||:...:..:    |.:::.::.||        
  Fly   937 SQVQNVSQPSTPATPSSAGSSSSGGLPFGNVSKSFISGERKD----PLNMLAKNGGS-------- 989

  Fly   444 NNSLKPVEKIVLKENTPGQDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMS 508
                        |.|.    ||:||:..|..|.|:.:||.::||.:|:|||||:|.::|:.|...
  Fly   990 ------------KRNA----LLKWCQNKTVGYRNIDITNFSSSWNDGLAFCAILHSYLPDRIPYD 1038

  Fly   509 KLSAHDVVGNCRIGFDAAESLGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHF 562
            :|:..:...|..:.|.||||:||...:...||..:..||.:.||:|:..:..:|
  Fly  1039 QLTPANKRRNFSLAFAAAESVGIGTTLNINDMCQIERPDWMQVMSYVTAVYKYF 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ehbp1NP_995865.2 NT-C2 12..165 CDD:287345
CH 460..562 CDD:237981 36/101 (36%)
DUF3585 <1027..1122 CDD:288945
CG13366NP_001036254.1 Ead_Ea22 554..684 CDD:290646
CH 992..1092 CDD:237981 37/103 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.