DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ehbp1 and smtna

DIOPT Version :9

Sequence 1:NP_995865.2 Gene:Ehbp1 / 36912 FlyBaseID:FBgn0034180 Length:1141 Species:Drosophila melanogaster
Sequence 2:XP_003199343.1 Gene:smtna / 100333230 ZFINID:ZDB-GENE-091204-245 Length:271 Species:Danio rerio


Alignment Length:248 Identity:62/248 - (25%)
Similarity:109/248 - (43%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 DKMVTSTPLEPNVNKDDVKP---------KKKRALFFTEKED-EQDLRVESVKEDTTKTIGDNST 376
            |:.:.:..|:..|:.::.|.         |:||     |:.| |:..|:|::::.|.   |..|.
Zfish    32 DEEILNNMLDKAVDFEERKMIRAAMRELLKRKR-----ERRDRERAARMENLRQGTG---GKTSA 88

  Fly   377 TKEKPKEESQSSKDASSVVVPSAKRPEL-QPLNLKKSYEPSQTPESAPVPASVINESIGSCFSTS 440
            :..|.::.|.....|......:|:...| ||.::.     |....|:|..:.|....:....:..
Zfish    89 SLSKDQKASNGPGGAQFNAHRTAQAKTLSQPTSVS-----SPKTVSSPAQSHVARVKMSGGSAVG 148

  Fly   441 GSLNNSLKPVEKIVLKENTPGQDLLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELI 505
            |.....:|             |.||:||:..|:.|..|.:.|.::||.:|:||||::|.|.||..
Zfish   149 GPNTKDVK-------------QMLLDWCRVKTEPYEGVNIQNFSSSWADGLAFCALVHRFFPEGF 200

  Fly   506 DMSKLSAHDVVGNCRIGFDAAESLG-IPRVIEPRDMNMLTVPDKLAVMTYLHQ 557
            :...|:.:|...|....|..||.|. .|.:::..|:..:..||...|.||:.:
Zfish   201 EYCTLNPYDRKSNFEKAFKTAERLADCPPLLDVDDLMRMREPDWKCVYTYIQE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ehbp1NP_995865.2 NT-C2 12..165 CDD:287345
CH 460..562 CDD:237981 34/99 (34%)
DUF3585 <1027..1122 CDD:288945
smtnaXP_003199343.1 Smoothelin 20..59 CDD:315226 4/26 (15%)
CH 153..256 CDD:306753 35/114 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.