DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and SYNJ1

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_003886.3 Gene:SYNJ1 / 8867 HGNCID:11503 Length:1612 Species:Homo sapiens


Alignment Length:351 Identity:114/351 - (32%)
Similarity:179/351 - (50%) Gaps:66/351 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TWNVG------THTPRNQDLSSLL----SLNGTTTCPD--NQLPDIYVIGFQEV----------- 57
            ||||.      :...:||.|:..|    .|.|.....|  ::..||:.|||:|:           
Human   578 TWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKRSKPTDIFAIGFEEMVELNAGNIVSA 642

  Fly    58 STTPQVLKIFNDDPWVLKIADSLS-DHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTG 121
            |||.|.|       |.:::..::| |:::|.:.|:||.|:.:.:|.:.:|.|.::::..:..:||
Human   643 STTNQKL-------WAVELQKTISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTG 700

  Fly   122 LGGLWGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDF 186
            :||..||||||:||:..:.|.:.|||||.||...::|||.||:.:|.  .|.:....|.:|.||:
Human   701 MGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFIEIA--RKLSFPMGRMLFSHDY 763

  Fly   187 VFWFGDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFV 251
            |||.||.|:|:  |:...:|:..:..|.:..|:..|||...:..|..|....|.:..||||:|:.
Human   764 VFWCGDFNYRI--DLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQVFRGFLEGKVTFAPTYKYD 826

  Fly   252 EGTNDYNLK---RRPAWCDRILHRVQSNIYPGITLSANQL-----SYQ--SHMDYT--------- 297
            ..::||:..   |.|||.||:|.|.:.  :| ...||..|     |:|  |.:.||         
Human   827 LFSDDYDTSEKCRTPAWTDRVLWRRRK--WP-FDRSAEDLDLLNASFQDESKILYTWTPGTLLHY 888

  Fly   298 ------LSDHKPVSATFN---YKVEA 314
                  .|||:||.|..:   ::|||
Human   889 GRAELKTSDHRPVVALIDIDIFEVEA 914

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 111/340 (33%)
SYNJ1NP_003886.3 Syja_N 99..379 CDD:280532
INPP5c_Synj1 572..907 CDD:197332 111/342 (32%)
DUF1866 906..1047 CDD:286093 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.