DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and INP52

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_014293.1 Gene:INP52 / 855618 SGDID:S000005050 Length:1183 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:109/334 - (32%)
Similarity:173/334 - (51%) Gaps:43/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TAIADLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEV--STTPQVLKIF 67
            |..:::.:|:.|:||..:: |..|||..|...|     |...||:.|:|.|||  .|...:|   
Yeast   586 TTHSNINLFVGTFNVNGNS-RRADLSKWLFPIG-----DKFKPDVVVLGLQEVIELTAGSIL--- 641

  Fly    68 NDDP-----WVLKIADSLSDHQ--FVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGL 125
            |.|.     |...:.|.|:.::  ::.:..:|:..:||..||:.....::||:.....:||.||:
Yeast   642 NADYTKSSFWETMVTDCLNQYEEKYLLLRVEQMSSLLILFFARSDRAYNIKEVGGSTKKTGFGGI 706

  Fly   126 WGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWF 190
            .||||||:||.....|...||.:||:|....:.||..||:.|..|..:...  :.|..||.:||.
Yeast   707 TGNKGAVAIRFDYGATSFCFVNTHLSAGASNIDERRNDYNNIYRNITFPRS--KTIPHHDSLFWL 769

  Fly   191 GDLNFRLSGDMSAWDVRTDVENQR--YAD-LLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVE 252
            ||||:|::  ::..:||.::..|:  |.| ||:.|||.....:|..|...:|....|.||:|:..
Yeast   770 GDLNYRIT--LTNDEVRRELRAQKDGYIDRLLQYDQLTQEINEGVVFQGFKEPTLQFRPTYKYDY 832

  Fly   253 GTNDYNLK---RRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEA 314
            ||::|:..   |.|:|.|||:::.: |::|        |:| |.....:||||||.|.:.     
Yeast   833 GTDNYDTSEKARTPSWTDRIIYKGE-NLHP--------LAY-SDAPLKISDHKPVYAAYR----- 882

  Fly   315 ANQTYTDEE 323
            ||..:.||:
Yeast   883 ANVKFVDEK 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 104/310 (34%)
INP52NP_014293.1 COG5329 1..628 CDD:227637 15/47 (32%)
COG5411 564..1052 CDD:227698 109/334 (33%)
Aim21 <978..1166 CDD:371558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.