DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and INP51

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_012264.3 Gene:INP51 / 854815 SGDID:S000001264 Length:946 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:111/331 - (33%)
Similarity:166/331 - (50%) Gaps:42/331 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEV---------STTPQVL 64
            |:.||..|:|:....|:: |:...:.....:  .::::.|:||||.:||         :|.|.|.
Yeast   526 DISIFAGTFNISGKIPKD-DIKDWIFPKSMS--KEDEMADLYVIGLEEVVELTPGHMLATDPYVR 587

  Fly    65 KIFNDDPWVLKIADSLS----DHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGL 125
            :.     |..||...|:    ..:::::.|.||.|||:.:|........:|.||.:..:||.||:
Yeast   588 QF-----WEKKILTLLNGPGRKKKYIRLWSTQLGGILLLLFMNETEYSKVKHIEGDVKKTGFGGM 647

  Fly   126 WGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWF 190
            ..|||||::......|....:.|||||..|.:::|..||..|..:.:: ::|. ||.|||.:.|.
Yeast   648 ASNKGAVAVSFKYSATRFCVLVSHLAAGLENVEQRHNDYKTIAKSIRF-SKGL-RIKDHDAIIWM 710

  Fly   191 GDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTN 255
            ||.|:|:.  ||..|||..:.::.||.|.:.||||.....|.:|....|...:|.||:||..||.
Yeast   711 GDFNYRIL--MSNEDVRRKIVSKEYASLFEKDQLNQQMIAGESFPYFHEMAIDFPPTYKFDPGTK 773

  Fly   256 DYNLK---RRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQ 317
            :|:..   |.|||.||||.|       |..|  .||.|:...|...|||:||.|.|..:|     
Yeast   774 NYDTSEKMRIPAWTDRILSR-------GEVL--EQLEYKCCEDILFSDHRPVYAIFRARV----- 824

  Fly   318 TYTDEE 323
            |..||:
Yeast   825 TVVDEQ 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 105/311 (34%)
INP51NP_012264.3 COG5329 1..501 CDD:227637
COG5411 498..946 CDD:227698 111/331 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.