DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and INP54

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_014576.1 Gene:INP54 / 854089 SGDID:S000005426 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:91/347 - (26%)
Similarity:146/347 - (42%) Gaps:86/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFLLTWNVGTHTPRNQDLSSLLSL-----NGTTTCPDNQLPDIYVIGFQEV-------------- 57
            :.:.|:|.|...|.....:.:..|     :|.:..   :|.|:||:|||||              
Yeast     8 VSVTTFNCGKEFPVENSKAIVKQLLFPYDDGISQL---ELQDLYVLGFQEVVPIWQGSFPAVNRD 69

  Fly    58 ---STTPQVLKIFNDDPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATR 119
               ..|...:...|:     |::.:..|.|:..:....|..|.|.:...:..:....:|   ..|
Yeast    70 LIDRITTTAVNCLNE-----KVSATQGDEQYSCLGVNSLGAITIIVLYNNNALKVKDDI---LKR 126

  Fly   120 TGLGGLWGN--KGAVSIRLSLYGTG------VAFVCSHLAAHD--EKLKERIEDYHQIV----DN 170
            .|..|.:|.  ||...|...:...|      .:::|:||.|::  ....:||:||.:|:    |:
Yeast   127 NGKCGWFGTHLKGGTLISFQMTRNGEENWERFSYICAHLNANEGVNNRNQRIDDYKRIMSEVCDS 191

  Fly   171 HKYNAQGYRRIFDHDFVFWFGDLNFRLSGDMSAWDVRTDVENQRYADLLKL----DQLNLLREKG 231
                     .:...|..|:.||||||::   |.:|..|:..:.  ..|.:|    ::||||| ||
Yeast   192 ---------EVAKSDHFFFLGDLNFRVT---STYDPTTNYSST--TTLRRLLENHEELNLLR-KG 241

  Fly   232 NAFSL---LEEQQPNFAPTFKF-VEGTNDYNLKRRPAWCDRILHR-------VQSNIYPGITLSA 285
            ....|   .:|.:..|.||:|| :.....||.||.|:||||||::       .|...|..:..| 
Yeast   242 EDEPLCKGFQELKITFPPTYKFKLFEKETYNTKRIPSWCDRILYKSYAVPTFAQEGTYHSVPRS- 305

  Fly   286 NQLSYQSHMDYTLSDHKPVSAT 307
            |.|.:        |||:||:.|
Yeast   306 NALLF--------SDHQPVNLT 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 91/347 (26%)
INP54NP_014576.1 COG5411 1..371 CDD:227698 91/347 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1642
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.