DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and 5PTASE11

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_175182.2 Gene:5PTASE11 / 841160 AraportID:AT1G47510 Length:334 Species:Arabidopsis thaliana


Alignment Length:310 Identity:98/310 - (31%)
Similarity:144/310 - (46%) Gaps:47/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ADLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFNDDPW 72
            |||||.::|||:.    .|.....|:.|.|     ..:..|:.|:|.||   .|:.    |.|. 
plant    52 ADLCIRIITWNMN----GNVSYEDLVELVG-----KERKFDLLVVGLQE---APKA----NVDQ- 99

  Fly    73 VLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRT-GLGGLWG-NKGAVSIR 135
            :|:.|.| ..|:.  :...:||.:.:.:|........:||::.|.... |.|||.| .||||:||
plant   100 LLQTASS-PTHEL--LGKAKLQSVQLYLFGPKNSHTLVKELKAERYSVGGCGGLIGRKKGAVAIR 161

  Fly   136 LSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIV------DNHKYNAQGYRRIFDHDFVFWFGDLN 194
            ::.....:.|:..||:||.:|:.:|..:...|.      |..|           .|...|.||||
plant   162 INYDDIKMVFISCHLSAHAKKVDQRNTELRHIANSLLPRDKRK-----------RDLTVWLGDLN 215

  Fly   195 FRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNL 259
            :|:. |:|...||:.::|...:.|:..|||....|:|..|....|....|.||:|:..|::||:.
plant   216 YRIQ-DVSNHPVRSLIQNHLQSVLVSKDQLLQEAERGEIFKGYSEGTLGFKPTYKYNVGSSDYDT 279

  Fly   260 K---RRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSA 306
            .   |.|||.||||.::|..    ..:.|...||.|......||||||.|
plant   280 SHKIRVPAWTDRILFKIQDT----DNIQATLHSYDSIDQVYGSDHKPVKA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 94/306 (31%)
5PTASE11NP_175182.2 EEP 56..325 CDD:294334 93/304 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.