DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and IP5PI

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_849745.1 Gene:IP5PI / 840311 AraportID:AT1G34120 Length:590 Species:Arabidopsis thaliana


Alignment Length:342 Identity:93/342 - (27%)
Similarity:156/342 - (45%) Gaps:71/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TPRNQDLSSLLSLNGTTTC----------------PDNQLPDIYVI----GFQEVSTTPQVLKIF 67
            ||...|.|..:.:|..:..                |..:|.:.||.    .|:.|:.|       
plant   271 TPNTPDRSLSMQINSDSKREERFSYTERVGLSWPEPPLRLLNQYVSERRGSFKSVNLT------- 328

  Fly    68 NDDPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAV 132
                     ..:|....:|::.|||:.|:.:|::.:.....|:..:.......|:.|..||||:|
plant   329 ---------ITNLRKPSYVRIVSKQMVGVFLTIWVRRNLRKHISNLCVSTVGVGIMGYIGNKGSV 384

  Fly   133 SIRLSLYGTGVAFVCSHLAAHD-----EKLKERIEDYHQIVD--NHKYNAQGY-RRIFDHDFVFW 189
            |:.:|:|.|...|:|:||::.:     ||..:.:.:.|:...  .|..||... |.|.:|:.:.|
plant   385 SVSMSIYQTPFCFLCTHLSSGEKDTDQEKRNDDVREIHRRTQFLPHSLNANELPRSICNHERIIW 449

  Fly   190 FGDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGT 254
            .||||:|:  ::|.......:..:.:..|::.|||:....|||.|....|...:||||:|:...:
plant   450 LGDLNYRI--NLSYEKTHELIARKEWQRLVEYDQLSREMTKGNLFEGWSEGTLDFAPTYKYEIDS 512

  Fly   255 NDY------NLKRRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVE 313
            .:|      :.||||||||||:...:     |:.|    .:|:.: :..||||:||:|||..:||
plant   513 ENYIGDDPESGKRRPAWCDRIIWNGK-----GMKL----FNYRRN-EIKLSDHRPVTATFLAEVE 567

  Fly   314 ---------AANQTYTD 321
                     |...||.:
plant   568 VLSPRKLQHALTLTYAE 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 86/318 (27%)
IP5PINP_849745.1 EEP 29..583 CDD:294334 92/339 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.