DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and BST1

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001318880.1 Gene:BST1 / 836633 AraportID:AT5G65090 Length:529 Species:Arabidopsis thaliana


Alignment Length:452 Identity:117/452 - (25%)
Similarity:185/452 - (40%) Gaps:159/452 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVTATAIADLCIFLLTWNVGTHTPRNQ-DLSSLLSLNGTTTCPDNQLPDIYVIGFQEV--STTPQ 62
            |...|.|.:|.:||.|||||..||.|. :|...|.:.||.        |:|:.||||:  .:...
plant    64 MAPTTEIRELRVFLATWNVGGRTPNNDLNLEDFLLVEGTA--------DLYICGFQEIVPLSAGN 120

  Fly    63 VLKIFNDDP---WVLKIADSLS------------------------------------------- 81
            ||.:.:::|   |:..|:.:|:                                           
plant   121 VLVVEDNEPAAKWLALISQALNKPKQESVYSNAAYSASRTTTCSSSSCGSEESRAPSSLSFFQRP 185

  Fly    82 -----------DHQFVK------------------------------------------------ 87
                       |...:|                                                
plant   186 NLKVLSRNYRVDSSLLKTCNCPVIDTSVGWEARRSKRFSDPSTDSSNNVEPENFRVHENFLFDDV 250

  Fly    88 --------------VDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIRLSL 138
                          :.|||:.|:.::::|:.:.|||:..:..::...|:.|..||||.::|.:||
plant   251 PATTKMPGQMSYRLIASKQMVGLFLSVWARRELIPHISHLRLDSVGRGIMGRLGNKGCIAISMSL 315

  Fly   139 YGTGVAFVCSHLAAHDEKLKE--RIEDYHQIVDNHKY-------NAQGYRRIFDHDFVFWFGDLN 194
            :.|...|||||||:.:::..|  |..|..:|:.:.::       |.....||.|||.|.|.||||
plant   316 HQTSFCFVCSHLASGEKEGDELRRNADVAEILKHTQFPKLTKNPNCHAPERIIDHDRVLWLGDLN 380

  Fly   195 FRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDY-- 257
            :|::  ::..:.|..:|:..:..||:.||||:.|..|..||..:|.|..||||:|:.:.::.|  
plant   381 YRVA--LTYEETRVLLEDNDWDTLLERDQLNMERGAGRVFSGFQEGQIFFAPTYKYSQNSDAYAG 443

  Fly   258 ------NLKRRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVE 313
                  ..:|.||||||||.:.:     ||    .|||| ...:...|||:||.|.|..:|:
plant   444 EMTKSKKKRRTPAWCDRILWKGE-----GI----EQLSY-IRGESRFSDHRPVCAIFAVEVD 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 111/434 (26%)
BST1NP_001318880.1 EEP 71..496 CDD:382041 114/445 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.