DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and AT5G04980

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001078529.1 Gene:AT5G04980 / 830380 AraportID:AT5G04980 Length:466 Species:Arabidopsis thaliana


Alignment Length:441 Identity:112/441 - (25%)
Similarity:171/441 - (38%) Gaps:154/441 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IADLCIFLLTWNVGTHTPRN-QDLSSLLSLNGTTTCPDNQLPDIYVIGFQEV------------- 57
            |..|.:|:.|||||..:|.: .:|.:||.::...        |:||:||||:             
plant    35 IQSLRVFVATWNVGGKSPHSGLNLDALLHVHSEF--------DVYVLGFQEIVPLNAGNVLVLGD 91

  Fly    58 ---------------------------STTP--------------------------QVLKIFN- 68
                                       ..||                          :.|||.| 
plant    92 NEPAAKWLAMINQSLNKSSSSSGGRLSPKTPSFGAGSMFFAKPSLKKISESFRTECRRKLKICNC 156

  Fly    69 ---------------------------------------------DDPWVLKIADSLSDHQFVK- 87
                                                         :|....|:|..:|:...:| 
plant   157 STFSEDIVRKYGRESCFRCPEGLVNQSGVLSDDEEDEDDDDDDEDEDEGGGKVASLVSNQMTMKY 221

  Fly    88 --VDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIRLSLYGTGVAFVCSHL 150
              |.|||:.||.:|::.:.:.|.|:..:...:...|:.|..||||.:::.|.||.|...|:||||
plant   222 GLVASKQMVGIFLTVWMRKELIQHVSHLRISSVTRGIMGCLGNKGCIAVSLQLYKTSFCFICSHL 286

  Fly   151 AAHDEKLKERIE--DYHQIVDNHKYN---AQGYRRIFD----HDFVFWFGDLNFRLSGDMSAWDV 206
            |:.:.:..||..  |..:|:.|..:.   ...:.|:.|    ||.|.|.||||:|::  :|..:.
plant   287 ASGEREGDERRRNLDVIEILKNTSFPRICRTSFTRVPDRITKHDRVIWLGDLNYRIA--LSYSET 349

  Fly   207 RTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDY---------NLKRR 262
            :|.::...:..||..|||.:.|:.|..|....|.:..||||:|:...::.|         |.:|.
plant   350 KTLLDKNAWDTLLNKDQLKIERDAGRVFKGWHEGKIFFAPTYKYSYNSDAYAGDTSKEKKNKRRT 414

  Fly   263 PAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVE 313
            ||||||||....     ||    .|||| ...:...|||:||.:.|...||
plant   415 PAWCDRILWHGD-----GI----RQLSY-VRGESRFSDHRPVCSVFVVDVE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 107/429 (25%)
AT5G04980NP_001078529.1 EEP 36..456 CDD:294334 111/440 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.