DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and IP5PII

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_567547.1 Gene:IP5PII / 827526 AraportID:AT4G18010 Length:646 Species:Arabidopsis thaliana


Alignment Length:283 Identity:97/283 - (34%)
Similarity:151/283 - (53%) Gaps:35/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIRLSLY 139
            |:.||   .::|::.|||:.||.::::.:.:...|:..::......||.|..||||:|||.::||
plant   382 KVKDS---QKYVRIVSKQMVGIYVSVWIRRRLRRHVNNLKVSPVGVGLMGYMGNKGSVSISMTLY 443

  Fly   140 GTGVAFVCSHL-AAHDEKLKERIE-DYHQIVDNHKY----NAQGYRRIFDHDFVFWFGDLNFRLS 198
            .:.:.|||||| :.|.:..::|.. |.::|:...::    :....|.|..||.||||||||:|| 
plant   444 QSRMCFVCSHLTSGHKDGAEQRRNADVYEIIRRTRFASVLDTDQPRTIPCHDQVFWFGDLNYRL- 507

  Fly   199 GDMSAWDVRTDVENQRYADLLKLDQLNLLRE--KGNAFSLLEEQQPNFAPTFKFVEGTNDY---N 258
             :||..:||..|..:|:.:|...||  |:||  :|:.|....|....|.||:|:...::.|   |
plant   508 -NMSDGEVRKLVSQKRWDELKNSDQ--LIRELRRGHVFDGWREGPIKFPPTYKYEFDSDRYAGEN 569

  Fly   259 L-----KRRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQT 318
            |     ||.||||||||.     :..||    .|..|: ..:..:|||:||::.||..||..:..
plant   570 LREPEKKRAPAWCDRILW-----LGKGI----RQECYK-RSEIRMSDHRPVTSIFNVGVEVFDHR 624

  Fly   319 YTDEELHEMTHGSASSPATPNVS 341
            .....||  .:.:|:|...|..|
plant   625 KLQRALH--VNNAAASAVHPEPS 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 87/248 (35%)
IP5PIINP_567547.1 PLN03191 1..646 CDD:215624 97/283 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.