DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and 5PTase12

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001323432.1 Gene:5PTase12 / 818994 AraportID:AT2G43900 Length:1348 Species:Arabidopsis thaliana


Alignment Length:381 Identity:103/381 - (27%)
Similarity:157/381 - (41%) Gaps:99/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TWNVG----THTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEV------------------- 57
            :||||    :|......|.|:.|..|           |.|:|.|||                   
plant   582 SWNVGQGKASHDALMSWLGSVASDVG-----------ILVVGLQEVEMGAGFLAMSAAKESVGGN 635

  Fly    58 --STTPQVLKIFNDDPWVLKIADSLSDHQ-FVKVDSKQLQGILITMFAQHKHIPHMKEIETEATR 119
              ||..|.        |:..|..:|.:.. |.::.|:||.|:||:::.:.....|:.:|:..|..
plant   636 EGSTIGQY--------WIDTIGKTLDEKAVFERMGSRQLAGLLISLWVRKNLRTHVGDIDVAAVP 692

  Fly   120 TGLGGLWGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRR---- 180
            .|.|...||||.|.:|:.::...:.|:..|||||.|.:..|..|:     :|.|....:.|    
plant   693 CGFGRAIGNKGGVGLRIRVFDRIMCFINCHLAAHLEAVNRRNADF-----DHIYKTMSFTRSSNA 752

  Fly   181 -------------------------------IFDHDFVFWFGDLNFRLSGDMSAWDVRTDVENQR 214
                                           :.:.|.|.:|||.|:||.|  .::|...|..:||
plant   753 HNAPAAGVSTGSHTTKSANNANVNTEETKQDLAEADMVVFFGDFNYRLFG--ISYDEARDFVSQR 815

  Fly   215 YADLLK-LDQLNLLREKGNAFSLLEEQQPNFAPTFKF------VEGTNDYNLKRRPAWCDRILHR 272
            ..|.|: .|||....:.|..|..:.|....|.||:||      :.|.:....||.||||||::.|
plant   816 SFDWLREKDQLRAEMKAGRVFQGMREAIITFPPTYKFERHRPGLGGYDSGEKKRIPAWCDRVIFR 880

  Fly   273 -----VQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQTYTDEE 323
                 .:|.......:.|:.:.|.:.||.|.||||||...|:.|:|..:::...:|
plant   881 DTRTSPESECSLDCPVVASIMLYDACMDVTESDHKPVRCKFHVKIEHVDRSVRRQE 936

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 99/364 (27%)
5PTase12NP_001323432.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.