DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and AT2G37440

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001323804.1 Gene:AT2G37440 / 818321 AraportID:AT2G37440 Length:479 Species:Arabidopsis thaliana


Alignment Length:393 Identity:106/393 - (26%)
Similarity:169/393 - (43%) Gaps:84/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEV--STTPQVLKIFNDDP 71
            ||.:|:.|||||..:|...     |.|......|.:  .||||:||||:  .....||...::.|
plant    82 DLKMFVGTWNVGGKSPHEG-----LDLKDWLKSPAD--ADIYVLGFQEIVPLNAGNVLGAEDNGP 139

  Fly    72 ---WVLKIADSLS----------DHQ----------------------------FVKVDSKQLQG 95
               |:..|.::|:          :|.                            :....|||:.|
plant   140 AAKWLSLIREALNNTNNLSPNELEHTKSSQQPRFSFSGLSDDTPIPCNSTPPRGYSLAASKQMVG 204

  Fly    96 ILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKE- 159
            |.:.::.:......:..::......|:.|..||||:|||.:||:.|.:.|||:||.:.:::..| 
plant   205 IFLCVWVRDDLRKRITNLKVSCVGRGIMGYLGNKGSVSISMSLHETSLCFVCTHLTSGEKEGDEL 269

  Fly   160 -RIEDYHQIVDNHKYNAQGY----RRIFDHDFVFWFGDLNFRLSGDMSAWDVRTDVENQRYADLL 219
             |..|..:|....:::....    ..|.|||.|.|.||||:||   .::.|:...:.|..:..||
plant   270 RRNLDVTEIFKRTRFSRSSKDSRPETIMDHDKVIWLGDLNYRL---RASSDLHEQLRNHDWESLL 331

  Fly   220 KLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDY--------NLKRRPAWCDRILHRVQSN 276
            :.|||.:.:..|..|...||.:..||||:|:...:::|        ..:|.||||||||.:..  
plant   332 EKDQLKIEQRAGRIFKGWEEGKIYFAPTYKYRINSDNYVVQTEKSKEKRRTPAWCDRILWKGD-- 394

  Fly   277 IYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQTYTDEELHEMTHGSASSPATPNVS 341
                   ...||.| ...:...|||:||.:.|:..::..||:....:.....|       .||..
plant   395 -------GMKQLWY-VRGESKFSDHRPVQSLFSVHIDLKNQSNRKTKPVNQNH-------RPNPV 444

  Fly   342 LSF 344
            |::
plant   445 LTY 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 97/352 (28%)
AT2G37440NP_001323804.1 EEP 6..424 CDD:412407 100/361 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.