DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and CVL1

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001189654.1 Gene:CVL1 / 817761 AraportID:AT2G32010 Length:594 Species:Arabidopsis thaliana


Alignment Length:261 Identity:80/261 - (30%)
Similarity:130/261 - (49%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIR 135
            ||        :..|:..|.|||:.||.:|::.:.:...|:|.::......||.|..||||::||.
plant   320 PW--------NSSQYCLVASKQMVGIFLTIWVKSELREHVKNMKVSCVGRGLMGYLGNKGSISIS 376

  Fly   136 LSLYGTGVAFVCSHLAAHDEKLKE--RIEDYHQIVDNHKY-------NAQGYRRIFDHDFVFWFG 191
            :.|:.|...|||:||.:..::..|  |..|..:|:...::       :.:....|..||.|.|.|
plant   377 MLLHQTSFCFVCTHLTSGQKEGDELRRNSDVMEILKKTRFPRVQSSADEKSPENILQHDRVIWLG 441

  Fly   192 DLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTND 256
            |||:|::  :|....:..||.|.:..||:.|||.:.:::|:.|....|.:..|.||:|:...::.
plant   442 DLNYRIA--LSYRSAKALVEMQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSNNSDR 504

  Fly   257 Y--------NLKRRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVE 313
            |        ..:|.||||||||...:         ..:|||| ...:...|||:||...|:.:||
plant   505 YAGGDLHPKEKRRTPAWCDRILWHGE---------GLHQLSY-VRGESRFSDHRPVYGIFSAEVE 559

  Fly   314 A 314
            :
plant   560 S 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 77/253 (30%)
CVL1NP_001189654.1 EEP 17..582 CDD:412407 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I1643
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.