DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and inpp5j

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_002934320.2 Gene:inpp5j / 779554 XenbaseID:XB-GENE-984978 Length:787 Species:Xenopus tropicalis


Alignment Length:320 Identity:130/320 - (40%)
Similarity:186/320 - (58%) Gaps:28/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFND---- 69
            |..|:::|||||...|.: ||:|||.||..    |::: |::|||.|||::  .:.|...|    
 Frog   202 DFRIYVITWNVGCAVPPS-DLTSLLCLNAR----DDKI-DMFVIGLQEVNS--MINKRLKDALFS 258

  Fly    70 DPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSI 134
            |.|.....|.||...:|.|.|.::||.|:.:|:::.|:|.:::|:|:.|||||||.|||||.|||
 Frog   259 DQWSEVFMDVLSPFSYVLVSSVRMQGCLLLVFSKYFHLPFLRDIQTDCTRTGLGGYWGNKGGVSI 323

  Fly   135 RLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDLNFRLSG 199
            ||||:|..|.|:..||.||.|...:|::::..|:...::.......:.|||.||||||||||:. 
 Frog   324 RLSLFGHMVCFLNCHLPAHMENTDQRVDNFESILQLQQFQGPLANGVLDHDLVFWFGDLNFRIE- 387

  Fly   200 DMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNL---KR 261
            |:....|::.::..:.|.|.:.||||:.:......:...|....|.||:||..|||.|:.   ||
 Frog   388 DLDLHFVKSAIQGNKLALLWEKDQLNMAKIFEPVLNGFMEGSLTFPPTYKFDVGTNTYDTSSKKR 452

  Fly   262 RPAWCDRILHRVQSNIYPGIT------------LSANQLSYQSHMDYTLSDHKPVSATFN 309
            :|||.||||.:::..|.....            ||...|||.|||.||.||||||||.|:
 Frog   453 KPAWTDRILWKMKCPITQSPAKQLGTISTRSKELSVTLLSYGSHMQYTESDHKPVSAIFS 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 128/314 (41%)
inpp5jXP_002934320.2 INPP5c_INPP5J-like 203..513 CDD:197328 129/319 (40%)
SKICH 524..625 CDD:407623
Abhydrolase 652..>749 CDD:419691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D336369at33208
OrthoFinder 1 1.000 - - FOG0001973
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.