DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Inppl1

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_075233.1 Gene:Inppl1 / 65038 RGDID:68396 Length:1257 Species:Rattus norvegicus


Alignment Length:367 Identity:108/367 - (29%)
Similarity:168/367 - (45%) Gaps:72/367 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCIFLLTWNVGTHTPRNQDLSSLLSLNG--------TTTCPDNQLPDIYVIGFQEVSTTPQVLKI 66
            :.:|:.|||:|: .|..::::|..:..|        |.|.|.    ||||.|.||.|.       
  Rat   425 ISVFIGTWNMGS-VPPPKNVTSWFTSKGLGKALDEVTVTIPH----DIYVFGTQENSV------- 477

  Fly    67 FNDDPWV------LKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGL 125
             .|..|:      ||   .|:|..:..:..:.|..|.:.:..:.:|...:..:.|.:.:||:...
  Rat   478 -GDREWLDLLRGGLK---ELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANT 538

  Fly   126 WGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRI--------F 182
            .||||||.:.....||...||..||.:.:||...|.::|..|:   :..:.|.|::        |
  Rat   539 LGNKGAVGVSFMFNGTSFGFVNCHLTSGNEKTTRRNQNYLDIL---RLLSLGDRQLSAFDISLRF 600

  Fly   183 DHDFVFWFGDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPT 247
            .|  :|||||||:||  ||...::...:..:.:..||::|||||.|||...|....|::.:|.||
  Rat   601 TH--LFWFGDLNYRL--DMDIQEILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPT 661

  Fly   248 FKFVEGTND-YNLKRR---------PAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHK 302
            :::..|:.| |...::         |:||||||.:    .||...:..|  ||....|...|||.
  Rat   662 YRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWK----SYPETHIICN--SYGCTDDIVTSDHS 720

  Fly   303 PVSATFNYKV-----------EAANQTYTDEELHEMTHGSAS 333
            ||..||...|           :.::|.|.:.|..|....:||
  Rat   721 PVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTAS 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 99/327 (30%)
Inppl1NP_075233.1 SH2_SHIP 17..119 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..181
INPP5c_SHIP2-INPPL1 425..728 CDD:197335 101/331 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 897..986
SH3-binding 945..950
NPXY motif 984..987
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1004..1115
SAM_Ship2 1193..1255 CDD:188890
SAM 1201..1257 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.