DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and inpp5f

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_005156933.1 Gene:inpp5f / 570007 ZFINID:ZDB-GENE-041111-194 Length:1126 Species:Danio rerio


Alignment Length:212 Identity:42/212 - (19%)
Similarity:69/212 - (32%) Gaps:79/212 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDLNFRLSGDMSAWDVRTDVEN--QRYA 216
            :.|.|||:|                ||:.|..:..:       :..|...:.:..|:.|  ||..
Zfish   157 ENKEKERLE----------------RRLLDELYKIF-------MDSDSFYYSLTYDLTNTVQRQG 198

  Fly   217 DLLKLDQLNLLREKGNAF-------SLLEEQQP-----------NFAPTFKFVEGTNDYNLKRR- 262
            :|.|.||....|.....|       .|::.|.|           .|....:.|...|:.:.:.| 
Zfish   199 ELGKSDQPLWKRVDDRFFWNKHMIKDLVDLQAPQVDFWVIPIIQGFVQVEELVVNYNESSDEERS 263

  Fly   263 --------PAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYK-------V 312
                    |...|        :|:|..|::.  :|.:|.       |:   |...||       .
Zfish   264 SPETPLQEPTCVD--------DIHPRFTVAL--ISRRSR-------HR---AGMRYKRRGVDTDG 308

  Fly   313 EAANQTYTDEELHEMTH 329
            ..||...|::.:|..:|
Zfish   309 HVANYVETEQLIHVHSH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 35/182 (19%)
inpp5fXP_005156933.1 Syja_N 50..421 CDD:280532 42/212 (20%)
COG5329 65..574 CDD:227637 42/212 (20%)
hSac2 602..703 CDD:289241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.