DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and INPP5E

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_063945.2 Gene:INPP5E / 56623 HGNCID:21474 Length:644 Species:Homo sapiens


Alignment Length:352 Identity:97/352 - (27%)
Similarity:147/352 - (41%) Gaps:70/352 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLP-------DIYVIGFQEVSTTPQVLKI 66
            ::.:|:.|||:.........|...|            ||       |:||||.||..:..:    
Human   298 NVALFVATWNMQGQKELPPSLDEFL------------LPAEADYAQDLYVIGVQEGCSDRR---- 346

  Fly    67 FNDDPWVLKIADSLSDHQFVKVDSKQLQGIL-ITMFAQHKHIPHMKEIETEATRTGLGGLWGNKG 130
                .|..::.::|..|..:.  |....|:| :::|.:...|....|:|.....|.:......||
Human   347 ----EWETRLQETLGPHYVLL--SSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKG 405

  Fly   131 AVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIV----------DNHKYNAQGYRRIFDHD 185
            |:.|..:.:||...|:.||..:.|.|:.||:.||.:.|          |.:.|.:.........|
Human   406 ALGISFTFFGTSFLFITSHFTSGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFD 470

  Fly   186 FVFWFGDLNFRLSGDMSAWD------VRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNF 244
            .||||||.||||||..:..|      :..||     ..||:.|||.....||:.|...:|...:|
Human   471 EVFWFGDFNFRLSGGRTVVDALLCQGLVVDV-----PALLQHDQLIREMRKGSIFKGFQEPDIHF 530

  Fly   245 APTFKFVEGTNDY---NLKRRPAWCDRILHRV--QSNIYPGITLSANQLSYQSHMDYTLSDHKPV 304
            .|::||..|.:.|   :.:|.|::.||:|:|.  :.:|.|        :||.|......|||:||
Human   531 LPSYKFDIGKDTYDSTSKQRTPSYTDRVLYRSRHKGDICP--------VSYSSCPGIKTSDHRPV 587

  Fly   305 SATFNYKVEAANQTYT------DEELH 325
            ...|..||........      |.||:
Human   588 YGLFRVKVRPGRDNIPLAAGKFDRELY 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 91/324 (28%)
INPP5ENP_063945.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..193
PHA03247 <2..179 CDD:223021
13 X 4 AA repeats of P-X-X-P 10..242
INPP5c_INPP5E-like 295..593 CDD:197329 92/329 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.