DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and inpp5b

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_009290335.3 Gene:inpp5b / 563543 ZFINID:ZDB-GENE-110411-228 Length:907 Species:Danio rerio


Alignment Length:366 Identity:121/366 - (33%)
Similarity:182/366 - (49%) Gaps:33/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TAIADLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFND 69
            |.|.:...||.|:||...||: :.||..|:   :|..|    ||.|:|||||:..:.:.. :|||
Zfish   247 TYIENYSFFLGTYNVNGQTPK-ESLSPWLA---STASP----PDFYLIGFQELDLSKEAF-LFND 302

  Fly    70 DP----WVLKIADSL-SDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNK 129
            .|    |:|.:...| .|.::..|...:|.||::..:.:.:|.||:.|:|.|...||:.|..|||
Zfish   303 TPKEPEWMLAVYKGLHPDAKYALVKLVRLVGIMLLFYVKAEHAPHISEVEAETVGTGVMGRMGNK 367

  Fly   130 GAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYR----RIFDHDFVFWF 190
            ||||||...:.:.:..|.||||||.|:.:.|.:|:..|....::..:...    .|..|:.|.|.
Zfish   368 GAVSIRFQFHNSDICVVNSHLAAHTEEFERRNQDFKDICRRIQFRQEDPTLPPLTILKHNIVLWL 432

  Fly   191 GDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTN 255
            ||||:|:| |:....|:..:..:.:..|...|||....::...|....|.:.:|.||:|:..|::
Zfish   433 GDLNYRIS-DLEVDHVKDLISKKDFETLHTYDQLKRQMDEEVVFVGFTEGEIDFQPTYKYDTGSD 496

  Fly   256 DYNLK---RRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQ 317
            .::..   |.||||||||.|.:         |..||.|||||....|||||||:.....::..|:
Zfish   497 QWDTSEKCRVPAWCDRILWRGK---------SIKQLHYQSHMTLKTSDHKPVSSLLEIGIKVVNE 552

  Fly   318 TYTDEELHEMTH--GSASSPATPNVSLSFAFVVFVAVSYTQ 356
            ........|:..  ....:...|:||||.....|..|.:.|
Zfish   553 ESYKRTFEEIVRQIDRLENDCIPSVSLSEREFHFQDVKFMQ 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 109/307 (36%)
inpp5bXP_009290335.3 INPP5B_PH 6..146 CDD:318889
INPP5c_INPP5B 253..545 CDD:197327 109/310 (35%)
PapD-like 574..>648 CDD:317302 8/20 (40%)
RhoGAP_OCRL1 680..892 CDD:239845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.