DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Sh2d1b2

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001028671.1 Gene:Sh2d1b2 / 545378 MGIID:3622649 Length:132 Species:Mus musculus


Alignment Length:44 Identity:11/44 - (25%)
Similarity:18/44 - (40%) Gaps:9/44 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DHQFVKVDSKQLQGILITMFAQHKHIPHMK---------EIETE 116
            |..|:..||:.:.|.|....:..|.:.:.:         .||||
Mouse    25 DGNFLIRDSESVPGALCLCVSFKKLVYNYRIFREKNGYYRIETE 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 11/44 (25%)
Sh2d1b2NP_001028671.1 SH2_SAP1 1..103 CDD:198205 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.