powered by:
Protein Alignment CG6805 and Sh2d1b2
DIOPT Version :9
Sequence 1: | NP_611178.1 |
Gene: | CG6805 / 36911 |
FlyBaseID: | FBgn0034179 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028671.1 |
Gene: | Sh2d1b2 / 545378 |
MGIID: | 3622649 |
Length: | 132 |
Species: | Mus musculus |
Alignment Length: | 44 |
Identity: | 11/44 - (25%) |
Similarity: | 18/44 - (40%) |
Gaps: | 9/44 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 DHQFVKVDSKQLQGILITMFAQHKHIPHMK---------EIETE 116
|..|:..||:.:.|.|....:..|.:.:.: .||||
Mouse 25 DGNFLIRDSESVPGALCLCVSFKKLVYNYRIFREKNGYYRIETE 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6805 | NP_611178.1 |
EEP |
12..308 |
CDD:294334 |
11/44 (25%) |
Sh2d1b2 | NP_001028671.1 |
SH2_SAP1 |
1..103 |
CDD:198205 |
11/44 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167836210 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5411 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.