DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and OCRL

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001305713.1 Gene:OCRL / 4952 HGNCID:8108 Length:902 Species:Homo sapiens


Alignment Length:363 Identity:119/363 - (32%)
Similarity:175/363 - (48%) Gaps:41/363 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIF---NDDPWVL 74
            |:.||||...:|.:       .|.....|..|. ||||.|||||:..:.:....|   .:..|.:
Human   244 FVGTWNVNGQSPDS-------GLEPWLNCDPNP-PDIYCIGFQELDLSTEAFFYFESVKEQEWSM 300

  Fly    75 KIADSL-SDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIRLSL 138
            .:...| |..::.||...:|.|:::.:||:.....::::|.||...||:.|..||||.|::|...
Human   301 AVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAVRFVF 365

  Fly   139 YGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYR----RIFDHDFVFWFGDLNFRLSG 199
            :.|....|.||||||.|..:.|.:||..|.....:......    .|..|:.|.|.||||:||..
Human   366 HNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWLGDLNYRLCM 430

  Fly   200 DMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNLK---R 261
            . .|.:|::.:..:....|||.||||:.|.:..||....|.:..|.||:|:...|:.::..   |
Human   431 P-DANEVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCR 494

  Fly   262 RPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQTYTDEELHE 326
            .||||||||.| .:|:        |||:|:|||:...||||||||.|:..|:.     .||..:.
Human   495 VPAWCDRILWR-GTNV--------NQLNYRSHMELKTSDHKPVSALFHIGVKV-----VDERRYR 545

  Fly   327 MTHGSA-------SSPATPNVSLSFAFVVFVAVSYTQL 357
            .....:       .:...|::.||....||..|.:.||
Human   546 KVFEDSVRIMDRMENDFLPSLELSRREFVFENVKFRQL 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 107/305 (35%)
OCRLNP_001305713.1 PH_OCRL1 15..116 CDD:270182
Clathrin box 1 74..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..188
5-phosphatase 238..564 111/342 (32%)
INPP5c_INPP5B 241..534 CDD:197327 108/307 (35%)
ASH 565..679 7/19 (37%)
RhoGAP_OCRL1 669..897 CDD:239845
Clathrin box 2 703..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.