DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and CG7956

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001036740.2 Gene:CG7956 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster


Alignment Length:109 Identity:23/109 - (21%)
Similarity:42/109 - (38%) Gaps:32/109 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 TNDYNLKRRPAW---------CDRILHRVQS-----NIY-PGITL----SANQLSYQSHMDYTLS 299
            |:::::|  ..|         |..:.|.:..     |:| |.:.:    ||..:.|..|:.|.:.
  Fly    25 TSEFSIK--AGWDLSSVDDIECIGVTHGIVGVISLPNVYEPHLVVVKEASAVGVLYPPHLVYKIK 87

  Fly   300 DHKPVSATFNYKVEAANQTYTDEELHEMTHGSASSPATPNVSLS 343
            ....:||           ...|.:|...|..:.|:.:||..|:|
  Fly    88 SICILSA-----------DDPDTDLPNCTKHTKSNQSTPTHSVS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 15/72 (21%)
CG7956NP_001036740.2 Syja_N 174..413 CDD:280532
COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:289241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.