powered by:
Protein Alignment CG6805 and SH2D1A
DIOPT Version :9
Sequence 1: | NP_611178.1 |
Gene: | CG6805 / 36911 |
FlyBaseID: | FBgn0034179 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_002342.1 |
Gene: | SH2D1A / 4068 |
HGNCID: | 10820 |
Length: | 128 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 28/70 - (40%) |
Gaps: | 7/70 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 KIFNDDPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNK 129
||..:....|.:|..| |..::..||:.:.|:.......|.:|...:..:||. |.|..:
Human 10 KISRETGEKLLLATGL-DGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTET------GSWSAE 67
Fly 130 GAVSI 134
.|..:
Human 68 TAPGV 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165146103 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5411 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.