DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and INPP5B

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001352749.1 Gene:INPP5B / 3633 HGNCID:6077 Length:913 Species:Homo sapiens


Alignment Length:367 Identity:122/367 - (33%)
Similarity:183/367 - (49%) Gaps:33/367 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TAIADLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFND 69
            |.|.:...|..|:||...:|: :.|...|| ||.      |.||:|.:||||:..:.:.. .|:|
Human   260 TYIQNFRFFAGTYNVNGQSPK-ECLRLWLS-NGI------QAPDVYCVGFQELDLSKEAF-FFHD 315

  Fly    70 DP----WVLKIADSL-SDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNK 129
            .|    |...:::.| .|.::.||...:|.||::.::.:.:|..::.|:|.|...||:.|..|||
Human   316 TPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNK 380

  Fly   130 GAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKY----NAQGYRRIFDHDFVFWF 190
            |.|:||...:.|.:..|.||||||.|:.:.|.:||..|....::    .:.....|.:||.:.|.
Human   381 GGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHDVILWL 445

  Fly   191 GDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTN 255
            ||||:|:. ::....|:..:|.:.:..|...|||.:.......|....|.:..|.||:|:..|::
Human   446 GDLNYRIE-ELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSD 509

  Fly   256 DYNLK---RRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQ 317
            |::..   |.||||||||.: ..||        .||||||||....|||||||:.|:..|...|.
Human   510 DWDTSEKCRAPAWCDRILWK-GKNI--------TQLSYQSHMALKTSDHKPVSSVFDIGVRVVND 565

  Fly   318 TYTDEELHEMTHG--SASSPATPNVSLSFAFVVFVAVSYTQL 357
            ....:.|.|:...  ...:...|:||||.....|..|.|.||
Human   566 ELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQNVKYMQL 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 105/307 (34%)
INPP5BNP_001352749.1 INPP5B_PH 6..150 CDD:318889
INPP5c_INPP5B 265..558 CDD:197327 106/311 (34%)
RhoGAP_OCRL1 692..912 CDD:239845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.