DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and FIG4

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster


Alignment Length:199 Identity:37/199 - (18%)
Similarity:62/199 - (31%) Gaps:71/199 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 CSHLAAH-----DEKLKERIEDYHQIVDNHKYNAQGYRRIFDH-----DFVFWFG-DLNFRLSGD 200
            |:|:..|     .:.:..|:.:.......|.:..: |:|:|.:     :|.|.:. ||...|..:
  Fly   108 CAHIGRHLVYTIKDTVMVRVNEVTSQRPPHPHEDR-YKRMFQNIDLRSNFYFSYSYDLTRTLQYN 171

  Fly   201 MSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNLKRRPAW 265
            .||         .||.. .|:|              |:..:|                   .|.|
  Fly   172 ESA---------PRYVG-AKVD--------------LDRDEP-------------------LPDW 193

  Fly   266 CDRILHRVQSNIYPGITLSANQLSYQSHMDYTL-SDHKPVSATFNYKVEAANQTYTDEELHEMTH 329
                           .||::|.......:||.. ||.:.......|.::........:.|.|:||
  Fly   194 ---------------NTLTSNVDKAHERVDYAFRSDSRKRFVWNAYLLQPMEGIMLKDWLLEVTH 243

  Fly   330 GSAS 333
            |..|
  Fly   244 GFVS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 30/172 (17%)
FIG4NP_608841.1 COG5329 19..599 CDD:227637 37/199 (19%)
Syja_N 85..407 CDD:280532 37/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.