DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Ocrl

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster


Alignment Length:330 Identity:110/330 - (33%)
Similarity:167/330 - (50%) Gaps:49/330 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLCIFLLTWNVGTHT--PRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVST-------TPQVL 64
            |:.|:..||||...|  ..|..|.:.|:      |.:.. ||||.||.||:.|       :.||.
  Fly   184 DIIIYCATWNVNNKTCSDSNNPLRAWLA------CSEKP-PDIYAIGLQELDTPTKAMLNSTQVQ 241

  Fly    65 KIFNDDPWVLKIADSL-SDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGN 128
            .|  :..|:.|:.||: .|.::..:.|.:|...::|:..:.:...|:.....::...|:....||
  Fly   242 AI--EKQWIDKMMDSVHPDVEYEILMSHRLVATMLTVIVRKQLRQHIIRCRPKSVARGIFNTLGN 304

  Fly   129 KGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDL 193
            ||.|:|.|.|....:.||.||||||...::||.:||:.||:..::: .| |.|.|||.:||.|||
  Fly   305 KGGVAISLQLNEGNICFVNSHLAAHMGYVEERNQDYNAIVEGIRFD-DG-RTISDHDHIFWVGDL 367

  Fly   194 NFRLS--------GDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKF 250
            |:|:.        |.:|        :.|.|..||:.|||.....:|..|....|.:..|.||:|:
  Fly   368 NYRIQEPPGQQRPGPLS--------DAQTYELLLQYDQLRQEMRRGKCFEGYTEGEIKFRPTYKY 424

  Fly   251 VEGTNDYN---LKRRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKV 312
            ..||::|:   .:|.||:|||:|       :.|..:  .||:|.|.|:...||||||.|.|..||
  Fly   425 DPGTDNYDSSEKQRAPAYCDRVL-------WKGTRI--EQLAYNSIMEIRQSDHKPVYAVFQVKV 480

  Fly   313 EAANQ 317
            :..::
  Fly   481 KTRDE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 106/316 (34%)
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 107/320 (33%)
RhoGAP_OCRL1 614..823 CDD:239845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447403
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105940at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11200
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.