DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Inpp5k

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001013881.1 Gene:Inpp5k / 287533 RGDID:1359130 Length:446 Species:Rattus norvegicus


Alignment Length:314 Identity:117/314 - (37%)
Similarity:181/314 - (57%) Gaps:22/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFND----D 70
            |.|.::||||.:..| ..|||.||.||.    .|..| |||:||.||::.  .::.:.:|    |
  Rat    17 LSIHVVTWNVASAAP-TVDLSDLLQLNN----EDLNL-DIYIIGLQEMNY--GIISLLSDAAFED 73

  Fly    71 PWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIR 135
            ||.....|.||....||:...::||:|:.:||:::|:|:::.|.|::..|||.|.|||||.::|.
  Rat    74 PWSSFFMDMLSPLNLVKISQVRMQGLLLLVFAKYQHLPYIQIISTKSIPTGLYGYWGNKGGINIC 138

  Fly   136 LSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDLNFRLSGD 200
            |.|||..|:.|..||..|.....:|:|.:.:|:::..:.......|.|||.:.||||:|||:. |
  Rat   139 LKLYGYYVSIVNCHLPPHMYNNDQRLEHFDRILESLTFEGYDVPNILDHDLILWFGDMNFRIE-D 202

  Fly   201 MSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNL---KRR 262
            .....|:..:..:||.:|.:.|||.:.:::.......:|....|.||:||...:|:|:.   ||:
  Rat   203 FGLLFVQECITKKRYKELWEKDQLFIAKKQDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRK 267

  Fly   263 PAWCDRILHRVQ---SNIYP-GITLSANQLSYQSHMDYTLSDHKPVSATFNYKV 312
            |||.||||.|::   :...| |..|:  |..|.|||.|::||||||:.||:.::
  Rat   268 PAWTDRILWRLKRQPAKANPSGFLLT--QKDYVSHMTYSISDHKPVTGTFDLEL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 114/306 (37%)
Inpp5kNP_001013881.1 EEP 17..317 CDD:294334 117/310 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339863
Domainoid 1 1.000 207 1.000 Domainoid score I2785
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3555
OMA 1 1.010 - - QHG46410
OrthoDB 1 1.010 - - D336369at33208
OrthoFinder 1 1.000 - - FOG0001973
OrthoInspector 1 1.000 - - mtm9020
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1469
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.