DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and SPAC9G1.10c

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_593565.1 Gene:SPAC9G1.10c / 2542329 PomBaseID:SPAC9G1.10c Length:1191 Species:Schizosaccharomyces pombe


Alignment Length:363 Identity:102/363 - (28%)
Similarity:158/363 - (43%) Gaps:76/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCP----DNQLPDIYVIGFQEV-------STTPQ 62
            |:.|.:.:||.|...|.:.|..::    |.:..|    ||..|||.|.||||:       .|...
pombe   788 DVSILICSWNAGASKPSDLDSDTI----GASMIPMMIRDNGYPDIVVFGFQELVDLENKRLTARS 848

  Fly    63 VLKIFNDDP--------------WVLKI------ADSLSDHQFVKVDSKQLQGILITMFAQHKHI 107
            :|...:...              |..|:      ..|..|:|.:..::  |.|:...:|.::|..
pombe   849 ILSKSSSKGGSSNSANISSQYRLWREKLESEMMRVSSNDDYQVLVCEN--LVGLFSCVFVKNKLQ 911

  Fly   108 PHMKEIETEATRTGLGGLWGNKGAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHK 172
            ..::.:::...:||||||.|||||:.:|..:..|....|..||||.......|..|...|:||..
pombe   912 SKIRMLQSTTVKTGLGGLHGNKGAIVVRFLVDDTSYCIVNCHLAAGQSNKAARNNDLATILDNAS 976

  Fly   173 YNAQGYRR--------------IFDHDFVFWFGDLNFRLSG-DMSAWDV--RTDVENQRYADLLK 220
            ...:....              |.||:.....||||:|::. ...|.|:  :.|::.     ||:
pombe   977 LFPENDETDQLNTFVGGGDGSLIMDHEVCVLHGDLNYRINTLRPKALDLIKKNDIKT-----LLQ 1036

  Fly   221 LDQLNLLREKGNAFSL--LEEQQPNFAPTFKFVEGTNDYN---LKRRPAWCDRILHRVQSNIYPG 280
            .|||.:.|::...|.|  ..|.:..||||:|:...:..|:   .||.|||||||.:|.       
pombe  1037 SDQLLVERKRNAGFRLRTFTEPEITFAPTYKYDVHSEQYDSSEKKRVPAWCDRICYRG------- 1094

  Fly   281 ITLSANQLSYQSHMDYTL--SDHKPVSATFNYKVEAAN 316
               |.:.:|.:::..|.|  |||:||||..:.|.:..|
pombe  1095 ---SPDYISAENYTRYELKASDHRPVSALIHSKAKMVN 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 99/350 (28%)
SPAC9G1.10cNP_593565.1 COG5411 281..794 CDD:227698 2/5 (40%)
IPPc 787..1126 CDD:214525 101/358 (28%)
UBA_TAP-C_like 1161..1186 CDD:270459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.