DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and INPP5F

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_055752.1 Gene:INPP5F / 22876 HGNCID:17054 Length:1132 Species:Homo sapiens


Alignment Length:110 Identity:24/110 - (21%)
Similarity:41/110 - (37%) Gaps:34/110 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LKRRPA----------------WCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSAT 307
            ||:.|:                :|.|.:...|:.:              :|:..|.|..:..|..
Human   937 LKKSPSAGDVHILTGFAKPMDIYCHRFVQDAQNKV--------------THLSETRSVSQQASQE 987

  Fly   308 FNYKVEAANQTYTDEELHEMTHGSASSPATPNVSLSFAFVVFVAV 352
            .|   :..||. ::|...|.|..:.|.|:..:||||.....|::|
Human   988 RN---QMTNQV-SNETQSESTEQTPSRPSQLDVSLSATGPQFLSV 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 10/64 (16%)
INPP5FNP_055752.1 Syja_N 50..415 CDD:280532
hSac2 595..697 CDD:289241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 846..875
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 923..942 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..1017 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.