DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Sh2d1a

DIOPT Version :10

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001300617.1 Gene:Sh2d1a / 20400 MGIID:1328352 Length:144 Species:Mus musculus


Alignment Length:45 Identity:11/45 - (24%)
Similarity:18/45 - (40%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KIFNDDPWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPH 109
            ||..:....|.:|..| |..::..||:.:.|:.......|....|
Mouse    10 KISRETGEKLLLATGL-DGSYLLRDSESVPGVYCLCVFVHSAFQH 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:469791 11/45 (24%)
Sh2d1aNP_001300617.1 SH2 2..122 CDD:472789 11/45 (24%)

Return to query results.
Submit another query.