DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Inpp5k

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_006532570.1 Gene:Inpp5k / 19062 MGIID:1194899 Length:472 Species:Mus musculus


Alignment Length:323 Identity:116/323 - (35%)
Similarity:183/323 - (56%) Gaps:33/323 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFND----D 70
            |.:.::||||.:..| ..|||.||.||.    .|..| |||:||.||::.  .::.:.:|    |
Mouse    32 LSVHVVTWNVASAAP-TVDLSDLLQLNN----QDLNL-DIYIIGLQEMNF--GIISLLSDAAFED 88

  Fly    71 PWVLKIADSLSDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNKGAVSIR 135
            ||.....|.||...|||:...::||:|:.:||:::|:|:::.|.|::|.|||.|.|||||.|::.
Mouse    89 PWSSLFMDMLSPLNFVKISQVRMQGLLLLVFAKYQHLPYIQIISTKSTPTGLYGYWGNKGGVNVC 153

  Fly   136 LSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFDHDFVFWFGDLNFRLSGD 200
            |.|||..|:.:..||..|.....:|:|.:.:|:::..:.......|.|||.:.||||:|||:. |
Mouse   154 LKLYGYYVSIINCHLPPHMYNNDQRLEHFDRILESLTFEGYDVPNILDHDLILWFGDMNFRIE-D 217

  Fly   201 MSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTNDYNL---KRR 262
            .....|:..:..:.|.:|.:.|||.:.::........:|....|.||:||...:|:|:.   ||:
Mouse   218 FGLLFVQESITRKYYKELWEKDQLFIAKKNDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRK 282

  Fly   263 PAWCDRILHRVQ----------SNI---YPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKV 312
            |||.||||.|::          |::   |..:||.    :|.|||.|::||||||:.||:.::
Mouse   283 PAWTDRILWRLKRQPSQASPLASSVPTSYFLLTLK----NYVSHMAYSISDHKPVTGTFDLEL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 113/315 (36%)
Inpp5kXP_006532570.1 EEP 32..339 CDD:382041 116/319 (36%)
SKICH 350..454 CDD:375315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836198
Domainoid 1 1.000 207 1.000 Domainoid score I2871
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3490
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46410
OrthoDB 1 1.010 - - D336369at33208
OrthoFinder 1 1.000 - - FOG0001973
OrthoInspector 1 1.000 - - mtm8773
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5114
SonicParanoid 1 1.000 - - X1469
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.900

Return to query results.
Submit another query.