DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Inpp5b

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_006502867.1 Gene:Inpp5b / 16330 MGIID:103257 Length:994 Species:Mus musculus


Alignment Length:367 Identity:122/367 - (33%)
Similarity:185/367 - (50%) Gaps:33/367 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TAIADLCIFLLTWNVGTHTPRNQDLSSLLSLNGTTTCPDNQLPDIYVIGFQEVSTTPQVLKIFND 69
            |.|.:...|:.|:||...:|: :.|...||.:...       ||:|.:||||:..:.:.. .|:|
Mouse   341 TYIQNFRFFVGTYNVNGQSPK-ECLRPWLSHSALA-------PDVYCVGFQELDLSKEAF-FFHD 396

  Fly    70 DP----WVLKIADSL-SDHQFVKVDSKQLQGILITMFAQHKHIPHMKEIETEATRTGLGGLWGNK 129
            .|    |...:::|| .|.::.||...:|.||::.::.:.:|..::.|:|.|...||:.|..|||
Mouse   397 TPKEEEWFKAVSESLHPDAKYAKVKFVRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNK 461

  Fly   130 GAVSIRLSLYGTGVAFVCSHLAAHDEKLKERIEDYHQIVDNHKY----NAQGYRRIFDHDFVFWF 190
            |.|:||..|:.|.:..|.||||||.|:.:.|.:||..|....::    .:|....|..||.:.|.
Mouse   462 GGVAIRFQLHNTSICVVNSHLAAHTEEYERRNQDYRDICSRMQFPQVDPSQPPLTINKHDVILWL 526

  Fly   191 GDLNFRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTN 255
            ||||:|:. ::....|:..||.:.:..|...|||.:.......|....|.:..|.||:|:..|::
Mouse   527 GDLNYRIE-ELDVGKVKKLVEEKAFQTLYAHDQLKIQVAARTIFDGFTEGEITFQPTYKYDTGSD 590

  Fly   256 DYNLK---RRPAWCDRILHRVQSNIYPGITLSANQLSYQSHMDYTLSDHKPVSATFNYKVEAANQ 317
            |::..   |.||||||||.: ..||        .||||||||....|||||||:.|:..|...|:
Mouse   591 DWDTSEKCRAPAWCDRILWK-GKNI--------TQLSYQSHMALKTSDHKPVSSVFDIGVRVVNE 646

  Fly   318 TYTDEELHEMTHG--SASSPATPNVSLSFAFVVFVAVSYTQL 357
            ....:.|.|:...  ...:...|:|:||.....|..|.|.||
Mouse   647 ELYRKTLEEIVRSLDKMENANIPSVTLSKREFCFENVKYMQL 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 106/307 (35%)
Inpp5bXP_006502867.1 INPP5B_PH 1..150 CDD:374793
INPP5c_INPP5B 346..639 CDD:197327 107/311 (34%)
RhoGAP_OCRL1 773..991 CDD:239845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.