DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6805 and Inpp5f

DIOPT Version :9

Sequence 1:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_848756.2 Gene:Inpp5f / 101490 MGIID:2141867 Length:1132 Species:Mus musculus


Alignment Length:238 Identity:42/238 - (17%)
Similarity:75/238 - (31%) Gaps:87/238 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFD--HDFVF-----WFGDLN----- 194
            |.|::...|..::.||.....|:|:.....|:  :..:.:.|  ||.:.     |.....     
Mouse   388 GDAYLKQVLLFNNPKLTYVSFDFHEHCRGMKF--ENVQTLTDAIHDIIIDMKWCWVDQAGVICKQ 450

  Fly   195 ---FRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTND 256
               ||:: .|...| ||:|.....|.::...||..|       .::..:||              
Mouse   451 EGIFRVN-CMDCLD-RTNVVQAAIARVVMEQQLKKL-------GVMPPEQP-------------- 492

  Fly   257 YNLKRRPAWCDRILHRVQSNIYPGITLSANQLSYQ------SHMDYTLSDHKPVSATFNYKVEAA 315
                 .|..|:|....:.:|       :.:.:|.|      ...|:|.:..:.::......|.:|
Mouse   493 -----LPVKCNRTYQIMWAN-------NGDSISRQYAGTAALKGDFTRTGERKLAGVMKDGVNSA 545

  Fly   316 NQTY-----------------------------TDEELHEMTH 329
            |:.|                             |.|:.||..|
Mouse   546 NRYYLSRFKDAYRQAVIDLMQGVPVTEDLYSIFTKEKEHEALH 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6805NP_611178.1 EEP 12..308 CDD:294334 33/186 (18%)
Inpp5fNP_848756.2 Syja_N 50..415 CDD:280532 7/26 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269
hSac2 595..697 CDD:289241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 833..872
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 908..951
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.