Sequence 1: | NP_611178.1 | Gene: | CG6805 / 36911 | FlyBaseID: | FBgn0034179 | Length: | 357 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848756.2 | Gene: | Inpp5f / 101490 | MGIID: | 2141867 | Length: | 1132 | Species: | Mus musculus |
Alignment Length: | 238 | Identity: | 42/238 - (17%) |
---|---|---|---|
Similarity: | 75/238 - (31%) | Gaps: | 87/238 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 GVAFVCSHLAAHDEKLKERIEDYHQIVDNHKYNAQGYRRIFD--HDFVF-----WFGDLN----- 194
Fly 195 ---FRLSGDMSAWDVRTDVENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEGTND 256
Fly 257 YNLKRRPAWCDRILHRVQSNIYPGITLSANQLSYQ------SHMDYTLSDHKPVSATFNYKVEAA 315
Fly 316 NQTY-----------------------------TDEELHEMTH 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6805 | NP_611178.1 | EEP | 12..308 | CDD:294334 | 33/186 (18%) |
Inpp5f | NP_848756.2 | Syja_N | 50..415 | CDD:280532 | 7/26 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 250..269 | ||||
hSac2 | 595..697 | CDD:289241 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 833..872 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 908..951 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 981..1016 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167836204 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |