powered by:
Protein Alignment AsnRS-m and AT1G68420
DIOPT Version :9
Sequence 1: | NP_611176.1 |
Gene: | AsnRS-m / 36909 |
FlyBaseID: | FBgn0034177 |
Length: | 460 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_177009.1 |
Gene: | AT1G68420 / 843171 |
AraportID: | AT1G68420 |
Length: | 87 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 26/66 - (39%) |
Similarity: | 38/66 - (57%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 223 LGKTYTLSPAFRAENSKSPLHLAEFYMFEAELAHLEEMEKLAQFIEQMLKSVTNRLLETSGEDLS 287
:|..||.:|.||||.|.:..|||||:|.|.||| ...:|:.....|.::|.:...|||...:|:.
plant 1 MGDVYTFAPTFRAEKSHTSRHLAEFWMVEVELA-FAGVEEAMNCSEAVVKDMCTTLLEKCRDDME 64
Fly 288 F 288
:
plant 65 Y 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0017 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1056670at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.