DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS-m and SLC25A28

DIOPT Version :9

Sequence 1:NP_611176.1 Gene:AsnRS-m / 36909 FlyBaseID:FBgn0034177 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_112489.3 Gene:SLC25A28 / 81894 HGNCID:23472 Length:364 Species:Homo sapiens


Alignment Length:247 Identity:45/247 - (18%)
Similarity:75/247 - (30%) Gaps:81/247 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGDSLAIQGWIKN-----------------VRRLKNNTFLDINDGSTSSRFQVVVPRTPENQHLA 70
            ||:|..:.||::.                 ||:          |..:...::.:........|:.
Human    23 PGESALLDGWLQRGVGRGAGGGEAGACRPPVRQ----------DPDSGPDYEALPAGATVTTHMV 77

  Fly    71 PGSVI---------------AAVGKIQVAPNGSFELHANQVEML-----AEG--RLQEGYPFSPK 113
            .|:|.               ..:..:|..|...:.   |.:|.|     .||  |...|...:..
Human    78 AGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYR---NVLEALWRIIRTEGLWRPMRGLNVTAT 139

  Fly   114 QKHPPE--YVREHLHLRSRVDFVAAQMRVRHKAQKA-------IHD-YMDDQDFVQ-----INTP 163
            ...|..  |...:..|:..:..|.......|.|..|       :|| .|:..:.|:     .|:|
Human   140 GAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVATLLHDAAMNPAEVVKQRMQMYNSP 204

  Fly   164 LLTTNDC-------EGAGEVFRVQPDSQDLLKQMNRPNIPMEQSYFDSKVFL 208
            .....||       ||||..:|.......:       |:|.:..:|.:..||
Human   205 YHRVTDCVRAVWQNEGAGAFYRSYTTQLTM-------NVPFQAIHFMTYEFL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRS-mNP_611176.1 asnC 13..460 CDD:235176 45/247 (18%)
EcAsnRS_like_N 27..101 CDD:239813 13/110 (12%)
AsxRS_core 115..456 CDD:238399 25/116 (22%)
SLC25A28NP_112489.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60 3/29 (10%)
Solcar 1 70..158 15/90 (17%)
Mito_carr 71..161 CDD:395101 15/92 (16%)
Solcar 2 168..252 21/89 (24%)
Mito_carr 169..253 CDD:395101 21/88 (24%)
Solcar 3 259..352
Mito_carr <279..356 CDD:395101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.