DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS-m and slc25a28

DIOPT Version :9

Sequence 1:NP_611176.1 Gene:AsnRS-m / 36909 FlyBaseID:FBgn0034177 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001072892.1 Gene:slc25a28 / 780354 XenbaseID:XB-GENE-967691 Length:370 Species:Xenopus tropicalis


Alignment Length:187 Identity:36/187 - (19%)
Similarity:63/187 - (33%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 NTPLLTTNDC-------EGAGEVFRVQPDSQDLLKQMNRPNIPMEQSYFDSKVFLSVSGQLHLEA 218
            |:|.....||       ||||..:|.......:       |||.:..:|.:..||    |.||..
 Frog   207 NSPYRKVTDCIRVVWRNEGAGAFYRSYTTQLTM-------NIPFQAIHFMTYEFL----QEHLNP 260

  Fly   219 MTYGLGKTYTLSPAFR---AENSKSPLHLAEFYMFEAE-LA--------HLEEMEKLAQFIEQM- 270
            .......::.||.|..   |..:.:||.:.:..:...| ||        |:..|....:.:.|: 
 Frog   261 HRQYNPTSHMLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSSNISGHITGMANAFRTVYQVG 325

  Fly   271 -----LKSVTNRLLETSGEDLSFCQRNSNSNSDLPWLQVPWKIMSYDEALQVLQENK 322
                 .:.|..|::                 ..:|...:.|.:..:.:.:...|:.|
 Frog   326 GIAAYFRGVQARVI-----------------YQMPSTAIAWSVYEFFKYILTKQQEK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRS-mNP_611176.1 asnC 13..460 CDD:235176 36/187 (19%)
EcAsnRS_like_N 27..101 CDD:239813
AsxRS_core 115..456 CDD:238399 36/187 (19%)
slc25a28NP_001072892.1 Mito_carr 76..166 CDD:365909
Mito_carr 176..258 CDD:365909 16/61 (26%)
Mito_carr <284..361 CDD:365909 12/93 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.