DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AsnRS-m and SLC25A37

DIOPT Version :9

Sequence 1:NP_611176.1 Gene:AsnRS-m / 36909 FlyBaseID:FBgn0034177 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_057696.2 Gene:SLC25A37 / 51312 HGNCID:29786 Length:338 Species:Homo sapiens


Alignment Length:223 Identity:39/223 - (17%)
Similarity:64/223 - (28%) Gaps:103/223 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RFYSKSGRIAQILKTN---KP--GDSLAIQG----------WIKNVRRLKNNTFLDINDGSTSSR 55
            ::.|..|.:.:|::|.   :|  |.::.|.|          ..:|::|..|:.|           
Human    83 QYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVF----------- 136

  Fly    56 FQVVVPRTPENQHLAPGSVIAAVGKIQVAPNGSFELHANQVEMLAEGRLQEGYPFSPKQKHPPEY 120
                  ....|.|||.|  ||          ||.....:...|                 :|.|.
Human   137 ------HHQGNSHLANG--IA----------GSMATLLHDAVM-----------------NPAEV 166

  Fly   121 VREHLHL-----RSRVDFVAAQMRVRHKAQKAIHDYMDDQDFVQINTPLLTTNDCEGAGEVFRVQ 180
            |::.|.:     ||.:..:....|.                              ||.|..:|..
Human   167 VKQRLQMYNSQHRSAISCIRTVWRT------------------------------EGLGAFYRSY 201

  Fly   181 PDSQDLLKQMNRPNIPMEQSYFDSKVFL 208
            .....:       |||.:..:|.:..||
Human   202 TTQLTM-------NIPFQSIHFITYEFL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsnRS-mNP_611176.1 asnC 13..460 CDD:235176 37/216 (17%)
EcAsnRS_like_N 27..101 CDD:239813 16/83 (19%)
AsxRS_core 115..456 CDD:238399 17/99 (17%)
SLC25A37NP_057696.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Solcar 1 43..131 9/47 (19%)
Mito_carr 44..136 CDD:278578 11/52 (21%)
Solcar 2 141..225 27/148 (18%)
Mito_carr 142..224 CDD:278578 26/147 (18%)
Solcar 3 232..326
Mito_carr <252..330 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1056670at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.