DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AsnRS-m and mfn-1

DIOPT Version :9

Sequence 1:	NP_611176.1	Gene:	AsnRS-m / 36909	FlyBaseID:	FBgn0034177	Length:	460	Species:	Drosophila melanogaster
Sequence 2:	NP_496447.1	Gene:	mfn-1 / 174752	WormBaseID:	WBGene00012204	Length:	312	Species:	Caenorhabditis elegans

Alignment Length:	198	Identity:	42/198 - (21%)
Similarity:	65/198 - (32%)	Gaps:	77/198 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly   194 NIPMEQSYFDSKVFLSVSGQL------HLEAMTYGL-GKTYTL------SPAFRAENSKSPLHLA 245
            ::|....||  .|:..:.|.|      |...:.||. |...||      :|   ||..|..:.:|
Worm    86 SMPAHALYF--TVYEKMKGYLTGNSAGHSNTLAYGASGVVATLIHDAIMNP---AEVVKQRMQMA 145

  Fly   246 -EFYMFEAELAH-LEEMEKLAQFIEQMLKSVTNRLLETSGEDLSFCQRNSNSNSDLPWLQVPWK- 307
             ..|....|.|. :...|.:|.|    .:|.|.:|.                      :.||::
Worm   146 FSPYGSSLECARCVYNREGVAAF----YRSYTTQLA----------------------MNVPFQA 184

  Fly   308 --IMSYDEALQVLQ-ENK------------------------DSLKTPISLNEGFSKD---QELF 342
              .|||:....||. |:|                        |.:||.::..:....|   :.:|
Worm   185 IHFMSYEFWQHVLNPEHKYDPKSHLIAGGLAGGLAAALTTPMDCVKTVLNTQQAAEADPANRRIF 249

  Fly   343 LVA 345
            |.|
Worm   250 LQA 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AsnRS-m	NP_611176.1	asnC	13..460	CDD:235176	42/198 (21%)
		EcAsnRS_like_N	27..101	CDD:239813
		AsxRS_core	115..456	CDD:238399	42/198 (21%)
mfn-1	NP_496447.1	Mito_carr	14..108	CDD:278578	6/23 (26%)
		Mito_carr	110..197	CDD:278578	25/115 (22%)
		Mito_carr	<223..308	CDD:278578	7/30 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1056670at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010