DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24a and OMA1

DIOPT Version :9

Sequence 1:NP_611175.1 Gene:ste24a / 36908 FlyBaseID:FBgn0034176 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_013013.2 Gene:OMA1 / 853962 SGDID:S000001795 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:53/292 - (18%)
Similarity:89/292 - (30%) Gaps:118/292 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 APLFDK------YTPLE--------KGALRQSIEDL-----AASLKFPLTKLFVVEGS-KRSSHS 255
            ||:.|:      ..|||        |...||:.:::     ..|:|.....:.:||.: |..|..
Yeast    86 APVSDRSRFIWVSRPLELTIGNYTYKSIWRQTQQEILPPQHPLSIKIENIFMKIVEAAYKDPSVD 150

  Fly   256 NAYFYGL-WN-----------------SKRIVLFDTLLLNKGKPDDSELSEEEKGKGC-TDEEVL 301
            |:...|: |.                 ..::.:|.::|                 ..| .|:.:.
Yeast   151 NSLLDGIKWEIHVVNDPTASPNAFVLPGGKVFIFSSIL-----------------PICANDDGIA 198

  Fly   302 AVLGHELGHWKLGHVTKNIIIMQVHLFLMFLVFGNVFKYPPFYVAMGFQPGTRPILVGLLIVFTY 366
            .||.||..|....|..:|:                  ...|.|..:|.          :|...|.
Yeast   199 TVLAHEFAHQLARHTAENL------------------SKAPIYSLLGL----------VLYTVTG 235

  Fly   367 VLAPYNALMN-FAMTILSRRFEYQADEFAFKL-------------------GFAEQLGQALIKLN 411
            ..|..|.|:: |.....||:.|.:||.....:                   .|.:|:.:.    .
Yeast   236 AHAINNILLDGFLRMPASRQMETEADYIGLMIMSRACFQPQESIKVWERMANFEKQMNRG----G 296

  Fly   412 VDNLGFPVYDWLYSTWNHSHPTLLQRLNRLKE 443
            |.|:.|      .||    ||...:|:..:.:
Yeast   297 VVNMEF------LST----HPASTRRIENMSK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24aNP_611175.1 Peptidase_M48_N 31..216 CDD:293100 2/4 (50%)
HtpX 153..440 CDD:223575 53/287 (18%)
Peptidase_M48 219..439 CDD:279743 50/272 (18%)
OMA1NP_013013.2 M48C_Oma1_like 132..323 CDD:320690 42/246 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.