DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24a and AT3G27110

DIOPT Version :9

Sequence 1:NP_611175.1 Gene:ste24a / 36908 FlyBaseID:FBgn0034176 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_566808.1 Gene:AT3G27110 / 822330 AraportID:AT3G27110 Length:344 Species:Arabidopsis thaliana


Alignment Length:238 Identity:51/238 - (21%)
Similarity:77/238 - (32%) Gaps:64/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 DLAASLKFPLTKLFVVEGSKRSSHSNAYFYGLWNSKRIVLFDTLLLNKGKPDDSELSEEEKGKGC 295
            :.|..|......|:|    ::|...|||...:...|..::..|.|:        ||        .
plant   136 EAAEILNIEAPDLYV----RQSPVPNAYTLAISGKKPFIVVHTSLI--------EL--------L 180

  Fly   296 TDEEVLAVLGHELGHWKLGHVTKNIIIMQVHLFLMFLVFGNVFKYPPFYVAMGFQPGTRPILVGL 360
            |..|:.|||.|||||.|..|.             ::|.|.|:.....:.|....|...|.:...|
plant   181 TSAELQAVLAHELGHLKCDHG-------------VWLTFANILTLGAYTVPAFGQMIARTLEEQL 232

  Fly   361 ---------------LIVFTYVLAPYNALMNFAMTILSRRFEYQADEF-----AFKLGFAEQLGQ 405
                           |:|........:.||..|....|...:...|.|     ::....:..||.
plant   233 LRWLRSAELTCDRAALLVAQDPKVVVSVLMKLAGGCPSIADQLNVDAFLEQARSYDKASSSPLGW 297

  Fly   406 ALIKLNVDNLGFP--------VYDWLYSTWNHSHPTLLQRLNR 440
            .:.......|..|        :.:|..|.   .:.:||:|.||
plant   298 YIRNAQTSQLSHPLPVLRAREIDEWSRSL---EYKSLLKRANR 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24aNP_611175.1 Peptidase_M48_N 31..216 CDD:293100
HtpX 153..440 CDD:223575 49/236 (21%)
Peptidase_M48 219..439 CDD:279743 49/235 (21%)
AT3G27110NP_566808.1 M48_Ste24p_like 116..321 CDD:320684 44/217 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10120
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.