DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24a and Oma1

DIOPT Version :9

Sequence 1:NP_611175.1 Gene:ste24a / 36908 FlyBaseID:FBgn0034176 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001100139.1 Gene:Oma1 / 298282 RGDID:1304821 Length:504 Species:Rattus norvegicus


Alignment Length:168 Identity:41/168 - (24%)
Similarity:66/168 - (39%) Gaps:53/168 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 TDEEVLA-VLGHELGHWKLGHVTKNIIIMQVHLFLMFLVFGNVFKYPPFYVAMGFQPGTRPILVG 359
            ||...|: :||||:.|..|||..:...:  ||| |.||  |.:|                     
  Rat   295 TDMHQLSFLLGHEIAHAVLGHAAEKASL--VHL-LDFL--GMIF--------------------- 333

  Fly   360 LLIVFTYVLAPYNALMNFAMTILSRRFEYQADE--------FAFKLGFAEQLGQALIKLNVDNL- 415
              :...:.:.|.::|......|.|:..||..|.        .|.|:|. :...:|.:.:...:: 
  Rat   334 --LTMIWAICPRDSLAVLGQWIQSKLQEYMFDRPYSRTLEAEADKIGL-QLAAKACVDVRASSVF 395

  Fly   416 -----------GFP-VYDWLYSTWNHSHPTLLQRLNRL 441
                       |:| :.:|| || :.||....:.|:||
  Rat   396 WQQMEFSESLHGYPKLPEWL-ST-HPSHGNRAEYLDRL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24aNP_611175.1 Peptidase_M48_N 31..216 CDD:293100
HtpX 153..440 CDD:223575 39/165 (24%)
Peptidase_M48 219..439 CDD:279743 38/164 (23%)
Oma1NP_001100139.1 Cardiolipin-binding. /evidence=ECO:0000250|UniProtKB:Q9D8H7 127..146
Stress-sensor region. /evidence=ECO:0000250|UniProtKB:Q9D8H7 144..174
Peptidase_M48 258..432 CDD:279743 41/168 (24%)
HtpX <264..434 CDD:223575 41/168 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.