DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24a and OMA1

DIOPT Version :9

Sequence 1:NP_611175.1 Gene:ste24a / 36908 FlyBaseID:FBgn0034176 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_660286.1 Gene:OMA1 / 115209 HGNCID:29661 Length:524 Species:Homo sapiens


Alignment Length:461 Identity:92/461 - (19%)
Similarity:161/461 - (34%) Gaps:158/461 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 CVFVLISNVLSTFKGL-------------PFKIYKIFVLEETHGFN--------KQTARFFAWDQ 158
            |..|.::::::.::||             .|..|..|..:.|.|.:        :.|::...|:.
Human    38 CHQVQVNHIVNKYQGLGVNQCDRWSFLPGNFHFYSTFNNKRTGGLSSTKSKEIWRITSKCTVWND 102

  Fly   159 L--KGFLVTQVLMI-------PITAAIIFIVQRGGDNFFIWLWIFTGVISLVLLTLYPI------ 208
            .  :..|:.:|..:       |::.|.|..::    ||..........:.|:|:.|.|:      
Human   103 AFSRQLLIKEVTAVPSLSVLHPLSPASIRAIR----NFHTSPRFQAAPVPLLLMILKPVQKLFAI 163

  Fly   209 ----FIAPLFDKYTPLEKGALRQSIEDLAASLKFPLTK---LFVV------EGSKRSSHSNAYF- 259
                .|...:....|.:|..::::|......|...|:.   ||||      |.|..:..|.... 
Human   164 IVGRGIRKWWQALPPNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRSKLLLL 228

  Fly   260 ------------YGLWNSK----------------RIVLFDTLLLNKGKPDDSELS--------- 287
                        |..|..:                :.||...:..||..|..|:::         
Human   229 GKEQFRLLSELEYEAWMEEFKNDMLTEKDARYLAVKEVLCHLIECNKDVPGISQINWVIHVVDSP 293

  Fly   288 -----EEEKGK---------GCTDEEVLA-VLGHELGHWKLGHVTKNIIIMQVHLFLMFLVFGNV 337
                 ....|:         ..||...|: :||||:.|..|||..:.  ...||| |.||  |.:
Human   294 IINAFVLPNGQMFVFTGFLNSVTDIHQLSFLLGHEIAHAVLGHAAEK--AGMVHL-LDFL--GMI 353

  Fly   338 FKYPPFYVAMGFQPGTRPILVGLLIVFTYVLAPYNALMNFAMTILSRRFEYQADE-FAFKL-GFA 400
            |                       :...:.:.|.::|......|.|:..||..:. ::.|| ..|
Human   354 F-----------------------LTMIWAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEA 395

  Fly   401 EQLGQAL-------IKLN---------VDNL-GFP-VYDWLYSTWNHSHPTLLQRLNRL--KELK 445
            :::|..|       |:.:         ||:| |.| :.:|| || :.||...::.|:||  :.||
Human   396 DKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWL-ST-HPSHGNRVEYLDRLIPQALK 458

  Fly   446 EEKKLN 451
            ..:..|
Human   459 IREMCN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24aNP_611175.1 Peptidase_M48_N 31..216 CDD:293100 23/140 (16%)
HtpX 153..440 CDD:223575 77/387 (20%)
Peptidase_M48 219..439 CDD:279743 63/301 (21%)
OMA1NP_660286.1 Cardiolipin-binding. /evidence=ECO:0000250|UniProtKB:Q9D8H7 148..167 4/18 (22%)
Stress-sensor region. /evidence=ECO:0000250|UniProtKB:Q9D8H7 165..195 4/29 (14%)
M48C_Oma1_like 263..456 CDD:320690 52/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.