DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24a and oma1

DIOPT Version :9

Sequence 1:NP_611175.1 Gene:ste24a / 36908 FlyBaseID:FBgn0034176 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_021324277.1 Gene:oma1 / 100331186 ZFINID:ZDB-GENE-091204-124 Length:510 Species:Danio rerio


Alignment Length:425 Identity:82/425 - (19%)
Similarity:138/425 - (32%) Gaps:159/425 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SCVFVLISNV---LSTFK-GLPFKIYKIFVLEETHGFNKQTARFFAWDQLKGFLVTQVLMIPITA 174
            |||.:..|.:   .|:|| |.|..:....|.:.|.||:....|    ..|....:..:::.|:..
Zfish    68 SCVSLGSSRLGLCSSSFKTGAPAALRAPVVFQRTRGFHTSGRR----RALPALPLLWMVLKPLQK 128

  Fly   175 AIIFIVQRGGDNFFIWL----------------WIFTGVISLVLLTLYPIFIAPLFDKYTPLEKG 223
            .:..|:.|....:::.|                |.|.|..:.:|      |||.|| .:|.|::.
Zfish   129 IMAIILGRSIRKWWVALPANKKQLFREWSWRRRWHFLGAGTGLL------FIASLF-FFTHLDES 186

  Fly   224 ---------------------------------------------------ALRQSIEDLAASLK 237
                                                               .|.|..:|:|....
Zfish   187 PITGRTRLLVFSRKNFRELAQFNADAFMEEFKDSLIASSDPRHKVVEQVVQILAQRNQDIAEISA 251

  Fly   238 FPLTKLFVVEGSKRSSHSNAYFYGLWNSKRIVLFDTLLLNKGKPDDSELSEEEKGKGCTD-EEVL 301
            .|.| :.||:    |...||:.  |.|.:..|.  |.:||                ..|| .::.
Zfish   252 VPWT-VHVVD----SPTMNAFV--LPNGEIFVF--TGMLN----------------AVTDIHQLT 291

  Fly   302 AVLGHELGHWKLGHVTKNIIIMQVHLFLMFLVFGNVFKYPP--FYVAMGFQPGTRPILVGLLIVF 364
            .:||||:.|..:||..:...:..|...|..::...::...|  ...|:|..      :.|.|:.|
Zfish   292 FILGHEMAHALIGHAAEQASLSHVVELLSLVLLTAIWAVCPRDSLAALGHW------IQGKLVQF 350

  Fly   365 TYVLAPYNALMNFAMTILSRRFEYQADEFAFKLG------------FAEQLGQALIKLNVDNLGF 417
            .:. .|:           ||:.|.:||:...::.            |.||:              
Zfish   351 LFD-RPF-----------SRKLEAEADQVGLQMAAKACADVRAGPVFWEQM-------------- 389

  Fly   418 PVYDWL-----YSTWNHSHPTLLQRLNRLKELKEE 447
            .::|.|     ...|..:||:...|:.:|..|..|
Zfish   390 EIFDQLSGQPTMPEWLSTHPSHQNRVRQLDRLIPE 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24aNP_611175.1 Peptidase_M48_N 31..216 CDD:293100 28/121 (23%)
HtpX 153..440 CDD:223575 65/373 (17%)
Peptidase_M48 219..439 CDD:279743 50/290 (17%)
oma1XP_021324277.1 M48C_Oma1_like 232..425 CDD:320690 52/250 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.