DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24b and AT3G27110

DIOPT Version :9

Sequence 1:NP_611174.1 Gene:ste24b / 36907 FlyBaseID:FBgn0034175 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_566808.1 Gene:AT3G27110 / 822330 AraportID:AT3G27110 Length:344 Species:Arabidopsis thaliana


Alignment Length:138 Identity:30/138 - (21%)
Similarity:46/138 - (33%) Gaps:49/138 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 HPFVGQ------SVPLENSNLRTQLEYLTRQV---------------------GFPMSQVRIIRV 249
            |||..|      ::|..|...:..|..:|.|:                     |..:....|:.:
plant    79 HPFDKQNTLLLRAIPGLNEFGKALLGSMTEQIMLLENIGTSVLVSKNQLSDLHGLLVEAAEILNI 143

  Fly   250 HDP------NTGSNAFFYGCCCLKRIVIFDTLLLNRGKSDLSHLTAEELGRGLADPQVVAVVAHE 308
            ..|      :...||:.......|..::..|.|:..       ||:.||         .||:|||
plant   144 EAPDLYVRQSPVPNAYTLAISGKKPFIVVHTSLIEL-------LTSAEL---------QAVLAHE 192

  Fly   309 LGHWRNGH 316
            |||.:..|
plant   193 LGHLKCDH 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24bNP_611174.1 Peptidase_M48_N 35..214 CDD:293100 1/1 (100%)
HtpX 167..444 CDD:223575 30/138 (22%)
Peptidase_M48 220..444 CDD:279743 26/124 (21%)
AT3G27110NP_566808.1 M48_Ste24p_like 116..321 CDD:320684 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10120
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.