DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ste24b and Oma1

DIOPT Version :9

Sequence 1:NP_611174.1 Gene:ste24b / 36907 FlyBaseID:FBgn0034175 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_080185.1 Gene:Oma1 / 67013 MGIID:1914263 Length:521 Species:Mus musculus


Alignment Length:307 Identity:69/307 - (22%)
Similarity:102/307 - (33%) Gaps:110/307 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 LYLQSLILTMIVLLLIPFMIHPFVGQS----VPLENSNLRTQLE-------------------YL 233
            |.|.:..|..:|.......:.|..|:|    |..|:..|.:.||                   ||
Mouse   193 LGLSAFGLLFVVFYFTHLEVSPVTGRSKLLLVGKEHFRLLSDLEYEVWMEEFKNDLLPERDPRYL 257

  Fly   234 T-RQVGFPMSQVR-----------IIRVHDPNTGSNAFFY--GCCCLKRIVIFDTLLLNRGKSDL 284
            | :::.:.::|..           ::.|.| :...|||..  |     ::.|| |.||| ..:|:
Mouse   258 TVKEMVYHLTQCNRDVPGISETNWVVHVVD-SPAVNAFVLPNG-----QVFIF-TGLLN-SVTDV 314

  Fly   285 SHLTAEELGRGLADPQVVAVVAHELGHWRNGHFYKAIMAFQVHLILTILLFAFLFSHGPIYQAVG 349
            ..|:              .::.||:.|...||  .|..|..||| |..|...||           
Mouse   315 HQLS--------------FLLGHEIAHAVLGH--AAEKASLVHL-LDFLGMIFL----------- 351

  Fly   350 FPPGLQPTVIGCLIIFGFVLTPYMTLANFSMLSMTRCFEYQADRFAYQLGYGGELRQALLKLYA- 413
                   |:|       :.:.|..:||.......::..||..|| .|......|..:..|:|.| 
Mouse   352 -------TMI-------WAICPRDSLAVLGQWIQSKLQEYMFDR-PYSRTLEAEADKVGLQLAAK 401

  Fly   414 ------------DNLAFPVS---DPCYSSWNHTHPT------MLDRL 439
                        ..:.|..|   .|....|..|||:      .||||
Mouse   402 ACADVRASSVFWQQMEFSESLHGYPKLPEWLSTHPSHGNRAEYLDRL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ste24bNP_611174.1 Peptidase_M48_N 35..214 CDD:293100 4/21 (19%)
HtpX 167..444 CDD:223575 69/307 (22%)
Peptidase_M48 220..444 CDD:279743 61/275 (22%)
Oma1NP_080185.1 Cardiolipin-binding. /evidence=ECO:0000269|PubMed:31819158 144..163
Stress-sensor region. /evidence=ECO:0000269|PubMed:24550258 161..191
M48C_Oma1_like 265..452 CDD:320690 54/235 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.