Sequence 1: | NP_001286511.1 | Gene: | Cbp53E / 36905 | FlyBaseID: | FBgn0004580 | Length: | 310 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_196349.1 | Gene: | APC3 / 830623 | AraportID: | AT5G07320 | Length: | 479 | Species: | Arabidopsis thaliana |
Alignment Length: | 201 | Identity: | 46/201 - (22%) |
---|---|---|---|
Similarity: | 81/201 - (40%) | Gaps: | 41/201 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 ENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKINDVSEDKLIEYT 182
Fly 183 DTMLQVFDANKDGRLQLSEMAKLLPVKENFLCR--------------------QVFKGATKLTKE 227
Fly 228 DIEKVFSLYDRDNSGTIENEELKGFLKDLL---ELVKKDDYDAQDLAAF----EETIMRGVGTDK 285
Fly 286 HGKISR 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cbp53E | NP_001286511.1 | EFh_HEF_CBN | 40..301 | CDD:320079 | 46/201 (23%) |
EF-hand motif | 40..68 | CDD:320079 | |||
EF-hand motif | 89..118 | CDD:320079 | 46/201 (23%) | ||
EF-hand motif | 135..164 | CDD:320079 | 4/28 (14%) | ||
EF-hand motif | 181..210 | CDD:320079 | 9/28 (32%) | ||
EF-hand motif | 228..257 | CDD:320079 | 10/28 (36%) | ||
EF-hand motif | 273..301 | CDD:320079 | 7/23 (30%) | ||
APC3 | NP_196349.1 | FRQ1 | 31..169 | CDD:227455 | 33/149 (22%) |
PTZ00169 | 218..476 | CDD:240302 | |||
Mito_carr | 292..381 | CDD:395101 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |