DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and APC3

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_196349.1 Gene:APC3 / 830623 AraportID:AT5G07320 Length:479 Species:Arabidopsis thaliana


Alignment Length:201 Identity:46/201 - (22%)
Similarity:81/201 - (40%) Gaps:41/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKINDVSEDKLIEYT 182
            |:.||..| :...|..:....::..:|..|.|:::..:::..|..|....:          .:|.
plant    21 EHVLLALR-ETMDEREIRIRSLFDFFDNSNLGFLDYAQIEKGLASLQIPPE----------YKYA 74

  Fly   183 DTMLQVFDANKDGRLQLSEMAKLLPVKENFLCR--------------------QVFKGATKLTKE 227
            ..:.:|.|||:|||:...|..:.:..||..|.|                    .:.|...::..|
plant    75 RDLFRVCDANRDGRVDYQEFRRYIDAKELELYRIFQAIDVEHNGCILPEELWEALVKAGIEIDDE 139

  Fly   228 DIEKVFSLYDRDNSGTIENEELKGFLKDLL---ELVKKDDYDAQDLAAF----EETIMRGVGTDK 285
            ::.:.....|:||:|||..||.:.||  ||   |...::.|...:....    |:.::.. |..|
plant   140 ELARFVEHVDKDNNGTITFEEWRDFL--LLYPHEATLENIYHHWERVCLIDIGEQAVIPD-GISK 201

  Fly   286 HGKISR 291
            |.|.||
plant   202 HVKRSR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 46/201 (23%)
EF-hand motif 40..68 CDD:320079
EF-hand motif 89..118 CDD:320079 46/201 (23%)
EF-hand motif 135..164 CDD:320079 4/28 (14%)
EF-hand motif 181..210 CDD:320079 9/28 (32%)
EF-hand motif 228..257 CDD:320079 10/28 (36%)
EF-hand motif 273..301 CDD:320079 7/23 (30%)
APC3NP_196349.1 FRQ1 31..169 CDD:227455 33/149 (22%)
PTZ00169 218..476 CDD:240302
Mito_carr 292..381 CDD:395101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.