DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and CALB1

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_004920.1 Gene:CALB1 / 793 HGNCID:1434 Length:261 Species:Homo sapiens


Alignment Length:266 Identity:123/266 - (46%)
Similarity:172/266 - (64%) Gaps:22/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSAN--ATDISPEAVTDTMLEELKSCFMEAY 97
            ::|:||.::|.|:|.||:||:||.||...::|...:..  ..::|||..|          |::.|
Human    11 ITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKT----------FVDQY 65

  Fly    98 DDNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRD 162
            ....||||.|.|||.:||.|||||||||... |:|..||||.||:||||:||:||.:||||||:|
Human    66 GQRDDGKIGIVELAHVLPTEENFLLLFRCQQ-LKSCEEFMKTWRKYDTDHSGFIETEELKNFLKD 129

  Fly   163 LLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFKGATKLTKE 227
            ||::|.|  .|.:.||.||||.||::||:|.||:|:|:|||:||||:||||.:  |:| .|:..:
Human   130 LLEKANK--TVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK--FQG-IKMCGK 189

  Fly   228 DIEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDKHGKISRK 292
            :..|.|.|||:|.:|.|:..||...||||.| ..|.|.|..::..:::.||   .....||:.|.
Human   190 EFNKAFELYDQDGNGYIDENELDALLKDLCE-KNKQDLDINNITTYKKNIM---ALSDGGKLYRT 250

  Fly   293 ELTMIL 298
            :|.:||
Human   251 DLALIL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 121/261 (46%)
EF-hand motif 40..68 CDD:320079 13/27 (48%)
EF-hand motif 89..118 CDD:320079 12/28 (43%)
EF-hand motif 135..164 CDD:320079 21/28 (75%)
EF-hand motif 181..210 CDD:320079 19/28 (68%)
EF-hand motif 228..257 CDD:320079 13/28 (46%)
EF-hand motif 273..301 CDD:320079 8/26 (31%)
CALB1NP_004920.1 Interaction with RANBP9. /evidence=ECO:0000269|PubMed:12684061 2..7
EFh_HEF_CB 16..259 CDD:320076 121/261 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141466
Domainoid 1 1.000 91 1.000 Domainoid score I7761
eggNOG 1 0.900 - - E33208_3BHMG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3386
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 1 1.010 - - QHG48379
OrthoDB 1 1.010 - - D415503at33208
OrthoFinder 1 1.000 - - FOG0003230
OrthoInspector 1 1.000 - - otm41835
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19972
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.820

Return to query results.
Submit another query.