DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and calb1

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001072811.1 Gene:calb1 / 780272 XenbaseID:XB-GENE-951983 Length:260 Species:Xenopus tropicalis


Alignment Length:265 Identity:127/265 - (47%)
Similarity:173/265 - (65%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KLSANQFMDVWAHYDKDGNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELKSCFMEAYD 98
            ::||:||:::|.|||.||||:|||.||..|:.|...:.....:.        |.:....|::.|:
 Frog    10 EISASQFLEIWRHYDTDGNGFIEGKELQNFILELQQARKKAGLD--------LSDQMKAFVDQYE 66

  Fly    99 DNQDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGYIEADELKNFLRDL 163
            :|.||||.|.||||:||.||||||.||  ..|:||.|||:.||.||||:||:||.||||:||:||
 Frog    67 NNTDGKIGIAELAQILPTEENFLLFFR--QQLKSSEEFMQSWRRYDTDHSGFIETDELKSFLKDL 129

  Fly   164 LKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLSEMAKLLPVKENFLCRQVFKGATKLTKED 228
            ||:|.|  ...|.||.|||.|||.:||.|.||:|.|:||:.||||:||||.:  |:| .|:..::
 Frog   130 LKKANK--PCEETKLEEYTHTMLLMFDTNNDGKLGLTEMSMLLPVQENFLLK--FQG-VKMCGKE 189

  Fly   229 IEKVFSLYDRDNSGTIENEELKGFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDKHGKISRKE 293
            ..|||.|||:|.:|.|:..||...||||.:..|| |.|..:|:.::::||   .....||:.|.|
 Frog   190 FNKVFELYDKDGNGYIDENELDDLLKDLCDKNKK-DLDINNLSTYKKSIM---ALSDGGKLYRTE 250

  Fly   294 LTMIL 298
            |.::|
 Frog   251 LALVL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 124/259 (48%)
EF-hand motif 40..68 CDD:320079 16/27 (59%)
EF-hand motif 89..118 CDD:320079 14/28 (50%)
EF-hand motif 135..164 CDD:320079 20/28 (71%)
EF-hand motif 181..210 CDD:320079 18/28 (64%)
EF-hand motif 228..257 CDD:320079 14/28 (50%)
EF-hand motif 273..301 CDD:320079 8/26 (31%)
calb1NP_001072811.1 EFh_HEF 16..258 CDD:355006 124/259 (48%)
EF-hand motif 16..44 CDD:320075 16/27 (59%)
EF-hand motif 57..86 CDD:320075 14/28 (50%)
EF-hand motif 101..130 CDD:320075 20/28 (71%)
EF-hand motif 145..174 CDD:320075 18/28 (64%)
EF-hand motif 189..218 CDD:320075 14/28 (50%)
EF-hand motif 233..258 CDD:320075 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I3250
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D415503at33208
OrthoFinder 1 1.000 - - FOG0003230
OrthoInspector 1 1.000 - - otm49057
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.