DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and TNNC2

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_003270.1 Gene:TNNC2 / 7125 HGNCID:11944 Length:160 Species:Homo sapiens


Alignment Length:192 Identity:52/192 - (27%)
Similarity:92/192 - (47%) Gaps:50/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TDISPEA---VTDTMLEELKSCFMEAYDDNQDGKIDIRELAQLL------PMEENFLLLFRFDNP 129
            ||...||   :::.|:.|.|:.| :.:|.:..|.|.::||..::      |.:|.          
Human     2 TDQQAEARSYLSEEMIAEFKAAF-DMFDADGGGDISVKELGTVMRMLGQTPTKEE---------- 55

  Fly   130 LESSVEFMKIWREYDTDNSGYIEADE-LKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANK 193
            |::.:|      |.|.|.||.|:.:| |...:|.:.::||   ..||::|.|    ..::||.|.
Human    56 LDAIIE------EVDEDGSGTIDFEEFLVMMVRQMKEDAK---GKSEEELAE----CFRIFDRNA 107

  Fly   194 DGRLQLSEMAKLLPVKENFLCRQVFKGATK-LTKEDIEKVFSLYDRDNSGTIENEELKGFLK 254
            ||.:...|:|            ::|:.:.: :|.|:||.:....|::|.|.|:.:|   |||
Human   108 DGYIDPEELA------------EIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDE---FLK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 52/192 (27%)
EF-hand motif 40..68 CDD:320079
EF-hand motif 89..118 CDD:320079 8/34 (24%)
EF-hand motif 135..164 CDD:320079 10/29 (34%)
EF-hand motif 181..210 CDD:320079 7/28 (25%)
EF-hand motif 228..257 CDD:320079 10/27 (37%)
EF-hand motif 273..301 CDD:320079
TNNC2NP_003270.1 PTZ00184 12..156 CDD:185504 48/182 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.