DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp53E and TpnC73F

DIOPT Version :9

Sequence 1:NP_001286511.1 Gene:Cbp53E / 36905 FlyBaseID:FBgn0004580 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001287091.1 Gene:TpnC73F / 39916 FlyBaseID:FBgn0010424 Length:155 Species:Drosophila melanogaster


Alignment Length:153 Identity:38/153 - (24%)
Similarity:66/153 - (43%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ESSVEFMKIWREYDTDNSGYIEADELKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDG 195
            |......|.:..:|...:|.|..:.:.:.||       .:....:.|::|   .:::..|.:|.|
  Fly    11 EQIAVLQKAFNSFDHQKTGSIPTEMVADILR-------LMGQPFDKKILE---ELIEEVDEDKSG 65

  Fly   196 RLQLSEMAKLLPVKENFLCRQVFKGATKLTKEDIEKVFSLYDRDNSGTIENEELKGFLKDLLELV 260
            ||:..|..:|   ...|:   |.:.|..:.|| :.:.|.|||:..:|.|....||..||:|.:.:
  Fly    66 RLEFGEFVQL---AAKFI---VEEDAEAMQKE-LREAFRLYDKQGNGFIPTTCLKEILKELDDQL 123

  Fly   261 KKDDYDAQDLAAFEETIMRGVGT 283
            .:.:.|..    .||....|.||
  Fly   124 TEQELDIM----IEEIDSDGSGT 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp53ENP_001286511.1 EFh_HEF_CBN 40..301 CDD:320079 38/153 (25%)
EF-hand motif 40..68 CDD:320079
EF-hand motif 89..118 CDD:320079
EF-hand motif 135..164 CDD:320079 6/28 (21%)
EF-hand motif 181..210 CDD:320079 7/28 (25%)
EF-hand motif 228..257 CDD:320079 10/28 (36%)
EF-hand motif 273..301 CDD:320079 5/11 (45%)
TpnC73FNP_001287091.1 PTZ00184 6..153 CDD:185504 38/153 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.